Recombinant Human Gap junction alpha-5 protein (GJA5) -VLPs

• Product Name Alternative:

  Connexin-40, Cx40

• Gene Name:

  GJA5

• UniProt:

  P36382

• Expression Region:

  1-358aa

• Organism:

  Homo sapiens (Human)

• Tag:

  C-terminal 10xHis-tagged

• Type:

  MP-VLP Transmembrane Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Others

• Endotoxin:

  Not tested

• Purity:

  The purity information is not available for VLPs proteins.

• Bioactivity:

  Not Tested

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

• Molecular Weight:

  41.8 kDa

• Shelf Life:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Transmembrane Domains:

  4TM

• Protein Length:

  Full Length

• Target Description:

  MGDWSFLGNFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGCQNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSCWEEGNGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTTLHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV