Recombinant Human Gap junction alpha-5 protein (GJA5) -VLPs

CAT:
399-CSB-MP009448HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Gap junction alpha-5 protein (GJA5) -VLPs - image 1

Recombinant Human Gap junction alpha-5 protein (GJA5) -VLPs

  • Product Name Alternative:

    Connexin-40, Cx40
  • Gene Name:

    GJA5
  • UniProt:

    P36382
  • Expression Region:

    1-358aa
  • Organism:

    Homo sapiens (Human)
  • Tag:

    C-terminal 10xHis-tagged
  • Type:

    MP-VLP Transmembrane Protein & In Stock Protein
  • Source:

    Mammalian cell
  • Field of Research:

    Others
  • Endotoxin:

    Not tested
  • Purity:

    The purity information is not available for VLPs proteins.
  • Bioactivity:

    Not Tested
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
  • Molecular Weight:

    41.8 kDa
  • Shelf Life:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Transmembrane Domains:

    4TM
  • Protein Length:

    Full Length
  • Target Description:

    MGDWSFLGNFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGCQNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSCWEEGNGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTTLHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV