S100B, Human (His)

• Description:

  The S100B protein binds calcium and zinc ions, each with a different site on the monomer. Physiological levels of potassium ions disrupt the binding of calcium and zinc, affecting high-affinity sites. S100B Protein, Human (His) is the recombinant human-derived S100B protein, expressed by E. coli , with N-6*His labeled tag.

• Product Name Alternative:

  S100B Protein, Human (His), Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/s100b-protein-human-his.html

• Purity:

  98.0

• Smiles:

  MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

• Molecular Formula:

  6285 (Gene_ID) P04271 (M1-E92) (Accession)

• Molecular Weight:

  Approximately 12.0 kDa

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins