Products for Research Use Only
RegisterLogin

SAE1, Human (GST)

CAT: 0804-HY-P71643Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71643Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
SAE1 protein, forming a heterodimer, acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and potentially SUMO4. It critically mediates ATP-dependent activation of SUMO proteins, enabling the formation of a thioester bond with UBA2/SAE2's active site cysteine. This process is essential for protein modification through sumoylation. SAE1 Protein, Human (GST) is the recombinant human-derived SAE1 protein, expressed by E. coli , with N-GST labeled tag.
Product Name Alternative
SAE1 Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sae1-protein-human-gst.html
Smiles
MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
Molecular Formula
10055 (Gene_ID) Q9UBE0 (M1-K346) (Accession)
Molecular Weight
Approximately 65.4 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS12412SAE1 Human Pre-designed siRNA Set A
HY-P82102-01SAE1 Antibody (YA1847, Rabbit)
HY-RS18047Sae1 Mouse Pre-designed siRNA Set A
HY-RS24521Sae1 Rat Pre-designed siRNA Set A
HY-P705432IL1B, Human (GST)
HY-P704096VAV1, Human (GST)
HY-P704074CHMP1B, Human (GST)
HY-P72192-01FCGRT, Human (GST)
HY-P701932ADH6, Human (GST)
HY-P702861ATP6V0D1, Human (GST)

Alternative Products

CatalogName
P528254SAE1 Protein (N-GST, Human)
TMPY-03062-01SAE1 Protein, Human, Recombinant (His & GST)
KMPH4443-01Human SAE1 Protein, His & GST Tag
P528255SAE1 Protein (N-GST & His, Human)
MBS8121585-01SAE1 Protein, Human, Recombinant (His & GST Tag)
P528253SAE1 & UBA2 Protein (N-His & N-GST, Human)
QP8183-ec-100ugRecombinant Human SAE1 Protein, GST, E.coli-100ug
QP8183-ec-50ugRecombinant Human SAE1 Protein, GST, E.coli-50ug
QP8183-ec-10ugRecombinant Human SAE1 Protein, GST, E.coli-10ug
QP8183-ec-200ugRecombinant Human SAE1 Protein, GST, E.coli-200ug

Popular Products