Recombinant Measles virus Phosphoprotein (P/V) , partial

Recombinant Measles virus Phosphoprotein (P/V) , partial

• CAS Number: 9000-83-3
• Gene Name: P/V
• UniProt: P03422
• Expression Region: 459-507aa
• Organism: Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)
• Target Sequence: ASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIMK
• Tag: N-terminal 6xHis-KSI-tagged
• Source: E.coli
• Field of Research: Microbiology
• Assay Type: Developed Protein
• Relevance: Essential component of the RNA polymerase and the nascent chain assembly complex. Also required during RNA synthesis.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Partial
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 21.1 kDa
• References & Citations: "Crystal structure of the measles virus phosphoprotein domain responsible for the induced folding of the C-terminal domain of the nucleoprotein." Johansson K., Bourhis J.M., Campanacci V., Cambillau C., Canard B., Longhi S. J Biol Chem 278:44567-44573 (2003)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.