Recombinant Human CD320 antigen (CD320) , partial

• Gene Name:

  CD320

• UniProt:

  Q9NPF0

• Expression Region:

  36-231aa

• Organism:

  Homo sapiens

• Target Sequence:

  SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV

• Tag:

  N-terminal GST-tagged

• Source:

  E.coli

• Field of Research:

  Immunology

• Assay Type:

  Developed Protein

• Relevance:

  Germinal center-B (GC-B) cells differentiate into mory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. Receptor for the cellular uptake of transcobalamin bound cobalamin.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Length:

  Partial

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Receptor for transcobalamin saturated with cobalamin (TCbl)

• Molecular Weight:

  47.1 kDa

• References & Citations:

  Identification of a human follicular dendritic cell molecule that stimulates germinal center B cell growth.Li L., Zhang X., Kovacic S., Long A.J., Bourque K., Wood C.R., Choi Y.S.J. Exp. Med. 191:1077-1084 (2000)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

• CAS Number:

  9000-83-3