ProTx-II-Biotin

• Description :

  N-ter biotin labeled version of the wild-type ProTx-II (Protoxin-II) which is a toxin that was originally isolated from Thrixopelma pruriens (Peruvian green velvet tarantula) .ProTx-II inhibits both tetrodotoxin-sensitive and tetrodotoxin-resistant channels. ProTx-II inhibits activation by shifting the voltage-dependence of channel activation to more positive potentials. ProTx-II potently inhibits all sodium channel subtypes tested (Nav1.2/SCN2A, Nav1.5/SCN5A, Nav1.7/SCN9A, and Nav1.8/SCN10A) . It is approximately 15-fold more potent on Nav1.7/SCN9A than on Nav1.5/SCN5A channels and acts on Cav3.1/CACNA1G and interacts more weakly with the related T-Type channel Cav3.2/CACNA1H but potently inhibits the L-type calcium channel Cav1.2/CACNA1C. ProTx-II also binds to phospholipids. ProTx-II, a selective inhibitor of Nav1.7 sodium channels, blocks action potential propagation in nociceptors.

• Specifications :

  Nav1.7 selective blocker

• Target :

  Na channels

• Sequence :

  YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

• Peptide Number :

  12PTB002

• Disulfide Bonds :

  Cys2-Cys16; Cys9-Cys21; Cys15-Cys25

• N Terminal Sequence :

  Biotin

• C Terminal Sequence :

  OH