Cycloviolacin O2

CAT:
466-SB111-0.5MG
Size:
0.5 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Cycloviolacin O2 - image 1

Cycloviolacin O2

  • Description:

    Cyclotide Cycloviolacin O2 peptide (CyO2) is a cyclotide isolated from Viola odorata. Cyclotides are circular peptides with remarkable characteristics including a head-to-tail cyclized backbone and 6 cysteine residues forming cyclic-cystine-knot motif (CCK) by three disulfide bonds. Cyclotides show potent cytotoxic activity that’s why they represent novel range of cytotoxic agents. Cycloviolacin O2 peptide Cycloviolacin O2 has antitumor effect and specific membrane-disrupting activity resulting in cell death and appears to be selective to tumoral cells. CyO2 has also demonstrated a potent bactericidal activity against Gram – bacteria with a MIC of 2.2µM on E. coli. Cycloviolacin O2 provides a potential scaffold for future drug design. Cycloviolacin O2 peptide is a head-to-tail cyclic peptide with three disulfide bridges between 1-4,2-5 and 3-6. SB-PEPTIDE is able to produce other cyclotides, including modified cyclotides with heavy isotope amino acids, biotin… Contact us to discuss about your project.
  • Sequence:

    GIPCGESCVWIPCISSAIGCSCKSKVCYRN
  • Peptide Number:

    SB111