Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
Oneq-H505-OneqH505100D	Ehrlichia chaffeensis
Oneq-H505-OneqH505150D	Ehrlichia chaffeensis
Oneq-H505-OneqH50550D	Ehrlichia chaffeensis
PCR-H505-PCRH50596D	Ehrlichia chaffeensis
PCR-H505-PCRH50548D	Ehrlichia chaffeensis
MBS1285992-002mgBaculovirus	Recombinant Ehrlichia chaffeensis Enolase (eno)
MBS1393295-05	Recombinant Ehrlichia chaffeensis Octanoyltransferase (lipB)
MBS1306785-002mgYeast	Recombinant Ehrlichia chaffeensis Dihydroorotase (pyrC)
MBS1306785-01mgEColi	Recombinant Ehrlichia chaffeensis Dihydroorotase (pyrC)
MBS1306785-01mgYeast	Recombinant Ehrlichia chaffeensis Dihydroorotase (pyrC)

Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES)

CAT:

399-CSB-EP337065EAW-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES)

Gene Name: groES
UniProt: P42386
Expression Region: 1-94aa
Organism: Ehrlichia chaffeensis
Target Sequence: MNLNMLHDNVLIEALEECNSSSPIQLPDSAKKKPTQGKVVAVGPGVYNHSGNILPMTIKVGDVVFYRQWAGNEIEFHEKKYIVMKESDIIAKEA
Tag: C-terminal 6xHis-tagged
Source: E.coli
Field of Research: Others
Assay Type: Developed Protein
Relevance: Together with the chaperonin GroEL, plays an essential role in assisting protein folding. The GroEL-GroES system forms a nano-cage that allows encapsulation of the non-native substrate proteins and provides a physical environment optimized to promote and accelerate protein folding. GroES binds to the apical surface of the GroEL ring, thereby capping the opening of the GroEL channel.
Purity: Greater than 95% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 17.5 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP644069EJS-03	Recombinant Ehrlichia chaffeensis Trigger factor (tig), partial
CSB-EP644069EJS-01	Recombinant Ehrlichia chaffeensis Trigger factor (tig), partial
CSB-EP337065EAW-03	Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES)
CSB-EP337065EAW-02	Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES)
CSB-EP337065EAW-01	Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES)
CSB-EP644069EJS-02	Recombinant Ehrlichia chaffeensis Trigger factor (tig), partial
CSB-YP018814PI-01	Recombinant Pig Trypsin
CSB-YP018814PI-03	Recombinant Pig Trypsin
CSB-YP837687MHV	Recombinant Profilin(A42R)
CSB-BP835645MO-02	Recombinant Recombinant Mouse Chitinase domain-containing protein 1 (Chid1)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on