Recombinant Human VEGF coregulated chemokine 1 protein (CXCL17) (Active)

Recombinant Human VEGF coregulated chemokine 1 protein (CXCL17) (Active)

• CAS Number: 9000-83-3
• Gene Name: CXCL17, VCC1, UNQ473/PRO842
• UniProt: Q6UXB2
• Expression Region: 22-119aa
• Organism: Homo sapiens
• Target Sequence: SSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL
• Tag: Tag-Free
• Source: E.Coli
• Field of Research: Immunology
• Assay Type: Active Protein & In Stock Protein
• Relevance: Plays a role in angiogenesis and possibly in the development of tumors. May be a housekeeping chemokine regulating recruitment of nonactivated blood monocytes and immature dendritic cells into tissues. May play a role in the innate defense against infections. {ECO:0000269|PubMed:16455961, ECO:0000269|PubMed:16989774, ECO:0000269|PubMed:17307946}.
• Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
• Purity: >96% as determined by SDS-PAGE.
• Activity: Yes
• Bioactivity: Fully biologically active when compared to standard. The ED50 as determined by its ability to induce VEGF expression using murine endothelial cells is less than 5.0 μg/ml, corresponding to a specific activity of ＞ 200 IU/mg.
• Length: Full Length of Mature Protein
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Function: Chemokine that acts as chemoattractant for monocytes, macrophages and dendritic cells
• Molecular Weight: 11.5 kDa
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.