Recombinant Pasteurella multocida Peptidoglycan-associated lipoprotein (pal)

CAT:
399-CSB-EP684401ESG-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Pasteurella multocida Peptidoglycan-associated lipoprotein (pal) - image 1

Recombinant Pasteurella multocida Peptidoglycan-associated lipoprotein (pal)

  • Gene Name:

    pal
  • UniProt:

    Q51886
  • Expression Region:

    20-150aa
  • Organism:

    Pasteurella multocida (strain Pm70)
  • Target Sequence:

    CGSSKKDESAGQMFGGYSVQDLQQRYNTVYFGFDKYNIEGEYVQILDAHAAFLNATPATKVVVEGNTDERGTPEYNIALGQRRADAVKHYLSAKGVQAGQVSTVSYGEEKPAVLGHDEAAYSKNRRAVLAY
  • Tag:

    N-terminal 6xHis-SUMO-tagged
  • Source:

    E.coli
  • Field of Research:

    Others
  • Assay Type:

    In Stock Protein
  • Relevance:

    Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity.
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Full Length of Mature Protein
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    27.3 kDa
  • References & Citations:

    "Pasteurella multocida produces a protein with homology to the P6 outer membrane protein of Haemophilus influenzae." Kasten R.W., Hansen L.M., Hinojoza J., Bieber D., Ruehl W.W., Hirsh D.C. Infect. Immun. 63:989-993 (1995)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3