Products for Research Use Only

PSMA, Human (HEK293, His, solution)

CAT: 0804-HY-P70548-01Size: 10 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70548-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
PSMA Protein is a type II transmembrane glycoprotein highly expressed on the surface of prostate cancer cells. PSMA Protein hydrolyzes extracellular polyglutamic acid folate into monoglutamic acid folate through folate hydrolase activity, improving the uptake efficiency of folate by tumor cells to support proliferation; and participates in neuropeptide metabolism through NAALADase activity. PSMA Protein, Human (HEK293, His, solution) is a recombinant PSMA protein expressed by HEK293 with an N-6*His tag.
Product Name Alternative
PSMA Protein, Human (HEK293, His, solution), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/psma-protein-human-hek-293-his.html
Purity
98.0
Smiles
KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Molecular Formula
2346 (Gene_ID) Q04609-1 (K44-A750) (Accession)
Molecular Weight
90-120 kDa
References & Citations
[1]Yao V, et al. Expression of prostate-specific membrane antigen (PSMA), increases cell folate uptake and proliferation and suggests a novel role for PSMA in the uptake of the non-polyglutamated folate, folic acid. Prostate. 2010 Feb 15;70 (3) :305-16.|[2]Kranzbühler B, et al. Pharmacological upregulation of prostate-specific membrane antigen (PSMA) expression in prostate cancer cells. Prostate. 2018 Jul;78 (10) :758-765.|[3]Hrkach J, et al. Preclinical development and clinical translation of a PSMA-targeted docetaxel nanoparticle with a differentiated pharmacological profile. Sci Transl Med. 2012 Apr 4;4 (128) :128ra39.|[4]Yuan W, et al. Glycoforms of human prostate-specific membrane antigen (PSMA) in human cells and prostate tissue. Prostate. 2022 Jan;82 (1) :132-144.|[5]Holmes EH. PSMA specific antibodies and their diagnostic and therapeutic use. Expert Opin Investig Drugs. 2001 Mar;10 (3) :511-9.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins

Popular Products