Recombinant Cricetulus griseus Uncharacterized protein | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS9420151-02	Recombinant Cricetulus griseus Cathepsin D
MBS7028577-02	Recombinant Cricetulus griseus Rhodopsin (RHO)
MBS1311385-002mgYeast	Recombinant Cricetulus griseus Calreticulin (CALR)
MBS1311385-05mgYeast	Recombinant Cricetulus griseus Calreticulin (CALR)
MBS7028577-03	Recombinant Cricetulus griseus Rhodopsin (RHO)
MBS1085439-01	Recombinant Cricetulus griseus Translin (TSN)
MBS1231001-002mgBaculovirus	Recombinant Cricetulus griseus Polyubiquitin, partial
MBS1231001-01mgEColi	Recombinant Cricetulus griseus Polyubiquitin, partial
MBS1406516-03	Recombinant Cricetulus griseus Transaldolase (TALDO1)
MBS9420151-03	Recombinant Cricetulus griseus Cathepsin D

Recombinant Cricetulus griseus Uncharacterized protein

CAT:

399-CSB-EP5481DXUa2-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Cricetulus griseus Uncharacterized protein

UniProt: G3HIE8
Expression Region: 1-64aa
Organism: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Target Sequence: MAGAGGRRAQGRFLRDGGFVMNQLSLKLTLCPTPDLGNKAHHDFSSYRNRKTNELQDQGLPNLN
Tag: N-terminal 6xHis-SUMO-tagged
Source: E.coli
Field of Research: Others
Assay Type: Developed Protein
Purity: Greater than 95% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 20.0 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Cricetulus griseus Uncharacterized protein, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP5481DXUa2-02	Recombinant Cricetulus griseus Uncharacterized protein
CSB-EP5481DXU-01	Recombinant Cricetulus griseus Uncharacterized protein
CSB-EP5481DXU-02	Recombinant Cricetulus griseus Uncharacterized protein
CSB-EP5481DXUa2-01	Recombinant Cricetulus griseus Uncharacterized protein
CSB-EP5481DXU-03	Recombinant Cricetulus griseus Uncharacterized protein
CSB-YP004458DXU-03	Recombinant Cricetulus griseus Calreticulin (CALR)
CSB-YP004458DXU-02	Recombinant Cricetulus griseus Calreticulin (CALR)
CSB-YP004458DXU-01	Recombinant Cricetulus griseus Calreticulin (CALR)
CSB-EP5481DXUa2-03	Recombinant Cricetulus griseus Uncharacterized protein
CSB-EP872876DXU-01	Recombinant Cricetulus griseus Peroxiredoxin-1 (PRDX1)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on