Products for Research Use Only
RegisterLogin

APBA3, Human (His)

CAT: 0804-HY-P7522Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7522Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
APBA3 Protein, Human (rHuAPBA3, His; Amyloid beta A4 precursor protein-binding family A member 3; APBA3) is an approximately 20.0 kDa APBA3 protein fused to His-tag. APBA3 Protein, Human (His) is an adapter protein that belongs to the X11 family and is involved in signal transduction processes[1].
Product Name Alternative
APBA3 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/apba3-protein-human-his.html
Smiles
MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQELVQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEECPPSQTGPEEPLEPAPRLHHHHHH
Molecular Formula
9546 (Gene_ID) O96018 (M1-L138) (Accession)
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]H Tanahashi, et al. Genomic organization of the human X11L2 gene (APBA3), a third member of the X11 protein family interacting with Alzheimer's beta-amyloid precursor protein. Neuroreport. 1999 Aug 20;10 (12) :2575-8.|[2]Toshiro Hara, et al. Deletion of the Mint3/Apba3 gene in mice abrogates macrophage functions and increases resistance to lipopolysaccharide-induced septic shock. J Biol Chem
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS16368APBA3 Human Pre-designed siRNA Set A
HY-RS26148Apba3 Rat Pre-designed siRNA Set A
HY-RS19655Apba3 Mouse Pre-designed siRNA Set A
HY-P76688UBE2F, Human (His)
HY-P71535-01TEAD4, Human (His)
HY-P76754-01CABP5, Human (His)
HY-P76504-01NAPG, Human (His)
HY-P75930-01MTSS1, Human (His)
HY-P75991-01PSME2, Human (His)
HY-P75691-01CSEN, Human (His)

Alternative Products

CatalogName
TMPJ-00722-01APBA3 Protein, Human, Recombinant (His)
P513218APBA3 Protein (C-His, Human)
KMH677-01Recombinant Human APBA3 Protein, His Tag
PR00933Recombinant Human APBA3 Protein, C-His
PKSH032064-01Recombinant Human APBA3 Protein (His Tag)
047191-01APBA3, Recombinant, Human, His-Tag discontinued
PV001965APBA3 Protein Vector (Human) (pPB-C-His)
PV322647APBA3 Protein Vector (Human) (pPB-His-GST)
PV322650APBA3 Protein Vector (Human) (pPB-His-MBP)
PV048892APBA3 Protein Vector (Human) (pPM-C-His)

Popular Products