Products for Research Use Only

IL-6, Human

CAT: 0804-HY-P7044-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7044-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. IL-6 Protein, Human (N-His) is the recombinant human-derived IL-6 protein, expressed by E. coli.
Product Name Alternative
IL-6 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-6-protein-human.html
Purity
98.0
Smiles
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular Formula
3569 (Gene_ID) P05231 (V30-M212) (Accession)
Molecular Weight
Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Nieken J, et al. Recombinant human interleukin-6 induces a rapid and reversible anemia in cancer patients. Blood. 1995 Aug 1;86 (3) :900-5.|[2]Castell JV, et al. Recombinant human interleukin-6 (IL-6/BSF-2/HSF) regulates the synthesis of acute phase proteins in human hepatocytes. FEBS Lett. 1988 May 23;232 (2) :347-50.|[3]Gao X, et al., PIM1 is responsible for IL-6-induced breast cancer cell EMT and stemness via c-myc activation. Breast Cancer. 2019 Sep;26 (5) :663-671|[4]Asano S, et al. In vivo effects of recombinant human interleukin-6 in primates: stimulated production of platelets[J]. Blood, 1990, 75 (8) : 1602-1605.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins