Syntaxin-8, Human

• Description:

  Syntaxin-8 is a vesicular transport protein that promotes retrograde transport within the early secretory pathway. It is essential for homotypic fusion of late endosomes, forming a SNARE complex with STX7, VTI1B, and VAMP8. Syntaxin-8 Protein, Human is the recombinant human-derived Syntaxin-8 protein, expressed by E. coli , with tag free.

• Product Name Alternative:

  Syntaxin-8 Protein, Human, Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/syntaxin-8-protein-human.html

• Smiles:

  MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCG

• Molecular Formula:

  9482 (Gene_ID) Q9UNK0 (M1-G215) (Accession)

• Molecular Weight:

  Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Scientific Category:

  Recombinant Proteins