NPPB, Human

• Description :

  NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human is the recombinant human-derived BNP protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  NPPB Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/bnp-protein-human.html

• Purity :

  97.0

• Smiles :

  SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

• Molecular Formula :

  4879 (Gene_ID) P16860 (S103-H134) (Accession)

• Molecular Weight :

  Approximately 3.5 kDa

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins