Recombinant Mouse High mobility group protein B1 (Hmgb1)

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS398065-01	Insulin: Mouse, High sensitive (ELISA)
HEB805Mu-1x48wellstestplate	High Sensitive Mouse High Molecular Weight Kininogen (HMWK) ELISA Kit
MBS2097843-04	High Sensitive Mouse High Molecular Weight Kininogen (HMWK) ELISA Kit
MBS2097843-05	High Sensitive Mouse High Molecular Weight Kininogen (HMWK) ELISA Kit
MBS968730-01	Recombinant Mouse High mobility group protein B1 (Hmgb1)
MBS968730-03	Recombinant Mouse High mobility group protein B1 (Hmgb1)
MBS1224689-02	Recombinant Mouse High mobility group protein B3 (Hmgb3)
MBS1224689-04	Recombinant Mouse High mobility group protein B3 (Hmgb3)
MBS1419401-03	Recombinant Mouse High mobility group protein 20A (Hmg20a)
MBS1419401-05	Recombinant Mouse High mobility group protein 20A (Hmg20a)

CAT:

399-CSB-EP010553MO-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Mouse High mobility group protein B1 (Hmgb1)

Gene Name: Hmgb1
UniProt: P63158
Expression Region: 2-215aa
Organism: Mus musculus
Target Sequence: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
Tag: N-terminal 6xHis-tagged
Source: E.coli
Field of Research: Epigenetics and Nuclear Signaling
Assay Type: In Stock Protein
Relevance: Multifunctional redox sensitive protein with various roles in different cellular compartments. In the nucleus is one of the major chromatin-associated non-histone proteins and acts as a DNA chaperone involved in replication, transcription, chromatin remodeling, V (D)J recombination, DNA repair and genome stability. Proposed to be an universal biosensor for nucleic acids. Promotes host inflammatory response to sterile and infectious signals and is involved in the coordination and integration of innate and adaptive immune responses. In the cytoplasm functions as sensor and/or chaperone for immunogenic nucleic acids implicating the activation of TLR9-mediated immune responses, and mediates autophagy. Acts as danger associated molecular pattern (DAMP) molecule that amplifies immune responses during tissue injury. Released to the extracellular environment can bind DNA, nucleosomes, IL-1 beta, CXCL12, AGER isoform 2/sRAGE, lipopolysaccharide (LPS) and lipoteichoic acid (LTA), and activates cells through engagement of multiple surface receptors. In the extracellular compartment fully reduced HMGB1 (released by necrosis) acts as a chemokine, disulfide HMGB1 (actively secreted) as a cytokine, and sulfonyl HMGB1 (released from apoptotic cells) promotes immunological tolerance (PubMed:23519706, PubMed:23446148, PubMed:23994764, PubMed:25048472). Has proangiogenic activity (PubMed:16365390). May be involved in platelet activation. Binds to phosphatidylserine and phosphatidylethanolamide. Bound to RAGE mediates signaling for neuronal outgrowth. May play a role in accumulation of expanded polyglutamine (polyQ) proteins (By similarity).
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 25.7 kDa
References & Citations: "A novel pathway of HMGB1-mediated inflammatory cell recruitment that requires Mac-1-integrin." Orlova V.V., Choi E.Y., XIe C., Chavakis E., Bierhaus A., Ihanus E., Ballantyne C.M., Gahmberg C.G., Bianchi M.E., Nawroth P.P., Chavakis T. EMBO J. 26:1129-1139 (2007)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Mouse High mobility group protein B1 (Hmgb1), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
CSB-YP010553MO-02	Recombinant Mouse High mobility group protein B1 (Hmgb1)
CSB-EP010553MO-02	Recombinant Mouse High mobility group protein B1 (Hmgb1)
CSB-YP010553MO-01	Recombinant Mouse High mobility group protein B1 (Hmgb1)
CSB-YP010553MO-03	Recombinant Mouse High mobility group protein B1 (Hmgb1)
CSB-EP010553MO-03	Recombinant Mouse High mobility group protein B1 (Hmgb1)
CSB-EP010553MO-01	Recombinant Mouse High mobility group protein B1 (Hmgb1)
CSB-EP010553MO1	Recombinant Mouse High mobility group protein B1 (HMGB1), partial
CSB-CF008532MO-01	Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a)
CSB-CF008532MO-02	Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a)
CSB-E12840m-02	Mouse High density lipoprotein, HDL ELISA Kit