Prolactin, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Prolactin, Human
Description :
Prolactin Protein acts on the mammary gland, promoting lactation through its interaction with the receptor PRLR. Prolactin Protein, Human is the recombinant human-derived Prolactin protein, expressed by E. coli , with tag free.Product Name Alternative :
Prolactin Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/prolactin-protein-human.htmlPurity :
98.0Smiles :
LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCMolecular Formula :
5617 (Gene_ID) P01236 (L29-C227) (Accession)Molecular Weight :
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins
