Recombinant Mouse Matrix metalloproteinase-14 (Mmp14) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS141591-01	Recombinant Mouse Matrix Metalloproteinase-2
MBS141732-02	Recombinant Mouse Matrix Metalloproteinase-9
MBS141732-04	Recombinant Mouse Matrix Metalloproteinase-9
MBS141591-03	Recombinant Mouse Matrix Metalloproteinase-2
MBS141732-03	Recombinant Mouse Matrix Metalloproteinase-9
MBS141591-04	Recombinant Mouse Matrix Metalloproteinase-2
MBS141732-01	Recombinant Mouse Matrix Metalloproteinase-9
MBS141591-02	Recombinant Mouse Matrix Metalloproteinase-2
MBS1048618-INQUIRE	Recombinant Mouse Matrix metalloproteinase-15 (Mmp15)
MBS955318-03	Recombinant Mouse Cartilage matrix protein (Matn1)

Recombinant Mouse Matrix metalloproteinase-14 (Mmp14)

CAT:

399-CSB-EP014661MO-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Mouse Matrix metalloproteinase-14 (Mmp14)

Gene Name: Mmp14
UniProt: P53690
Expression Region: 112-582aa
Organism: Mus musculus
Target Sequence: YAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Tag: C-terminal 6xHis-tagged
Source: E.coli
Field of Research: Cancer
Assay Type: Developed Protein
Relevance: Endopeptidase that degrades various components of the extracellular matrix such as collagen. Activates progelatinase A. Essential for pericellular collagenolysis and modeling of skeletal and extraskeletal connective tissues during development. May be involved in actin cytoskeleton reorganization by cleaving PTK7. Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues. Cleaves ADGRB1 to release vasculostatin-40 which inhibits angiogenesis.
Purity: Greater than 95% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 60.6 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Mouse Matrix metalloproteinase-14 (Mmp14), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP814316MOe1-03	Recombinant Mouse Matrix metalloproteinase-21 (Mmp21)
CSB-EP014667MO-01	Recombinant Mouse Matrix metalloproteinase-20 (Mmp20)
CSB-EP014661MO-03	Recombinant Mouse Matrix metalloproteinase-14 (Mmp14)
CSB-EP014661MO-02	Recombinant Mouse Matrix metalloproteinase-14 (Mmp14)
CSB-EP814316MOe1-02	Recombinant Mouse Matrix metalloproteinase-21 (Mmp21)
CSB-EP014667MO-03	Recombinant Mouse Matrix metalloproteinase-20 (Mmp20)
CSB-EP014661MO-01	Recombinant Mouse Matrix metalloproteinase-14 (Mmp14)
CSB-EP814316MOe1-01	Recombinant Mouse Matrix metalloproteinase-21 (Mmp21)
CSB-EP014667MO-02	Recombinant Mouse Matrix metalloproteinase-20 (Mmp20)
CSB-EP879497MO-01	Recombinant Mouse Matrix metalloproteinase-24 (Mmp24), partial

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on