Products for Research Use Only

IL-17RD, Mouse (CHO)

CAT: 0804-HY-P72794-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P72794-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Interleukin-17 receptor D (IL-17RD) also known as Sef (similar expression to fibroblast growth factor), is a type I transmembrane protein that can regulate several signaling pathways. Within the cell, IL-17RD expression has been localized mainly to the plasma membrane. IL-17RD is a feedback inhibitor of fibroblast growth factor (FGF) signaling[1]. IL-17RD Protein, Mouse (CHO) is produced in CHO cells, and consists of 2713 amino acids (G29-R299) .
Product Name Alternative
IL-17RD Protein, Mouse (CHO), Mouse, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-17rd-protein-mouse-cho.html
Purity
95.00
Smiles
GSGRARGADTCGWRGVGPASRNSGLHNITFRYDNCTTYLNPGGKHAIADAQNITISQYACHDQVAVTILWSPGALGIEFLKGFRVILEELKSEGRQCQQLILKDPKQLNSSFRRTGMESQPFLNMKFETDYFVKIVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMHVSFDHAPQNFGFRGFHVLYKLKHEGPFRRRTCRQDQNTETTSCLLQNVSPGDYIIELVDDSNTTRKAAQYVVKSVQSPWAGPIR
Molecular Formula
171463 (Gene_ID) Q8JZL1-1 (G29-R299) (Accession)
Molecular Weight
31-67 kDa
References & Citations
[1]Shivangi Pande, et al. Interleukin-17 receptor D (Sef) is a multi-functional regulator of cell signaling. Cell Commun Signal. 2021 Jan 12;19 (1) :6.|[2]Mark Mellett, et al. Orphan receptor IL-17RD regulates Toll-like receptor signalling via SEFIR/TIR interactions. Nat Commun. 2015 Mar 26;6:6669.|[3]Sihan Liu, et al. A shedding soluble form of interleukin-17 receptor D exacerbates collagen-induced arthritis through facilitating TNF-α-dependent receptor clustering. Cell Mol Immunol. 2021 Aug;18 (8) :1883-1895.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins