SNCA, Human

CAT:
804-HY-P70577-01
Size:
5 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SNCA, Human - image 1

SNCA, Human

  • Description:

    SNCA Protein is a protein abnormally aggregated to form Lewy bodies. SNCA Protein causes neuronal differentiation and maturation disorders, inhibits neurite outgrowth, reduces neuronal electrical activity through increased gene copy number (such as triploidy) or mutation, and promotes the release of extracellular toxic particles (such as oligomers) by interfering with the autophagy-lysosomal pathway (ALP), thereby inducing inflammatory responses and damage to neighboring cells. SNCA Protein, Human is a recombinant SNCA protein expressed by E. coli without a tag.
  • Product Name Alternative:

    SNCA Protein, Human, Human, E. coli
  • UNSPSC:

    12352202
  • Type:

    Recombinant Proteins
  • Assay Protocol:

    https://www.medchemexpress.com/cytokines/snca-protein-human.html
  • Purity:

    97.00
  • Smiles:

    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
  • Molecular Formula:

    6622 (Gene_ID) P37840-1 (M1-A140) (Accession)
  • Molecular Weight:

    Approximately 18.0 kDa
  • References & Citations:

    [1]Oliveira LM, et al. Elevated α-synuclein caused by SNCA gene triplication impairs neuronal differentiation and maturation in Parkinson's patient-derived induced pluripotent stem cells. Cell Death Dis. 2015 Nov 26;6 (11) :e1994.|[2]Poehler AM, et al. Autophagy modulates SNCA/α-synuclein release, thereby generating a hostile microenvironment. Autophagy. 2014;10 (12) :2171-92.|[3]Minakaki G, et al. Autophagy inhibition promotes SNCA/alpha-synuclein release and transfer via extracellular vesicles with a hybrid autophagosome-exosome-like phenotype. Autophagy. 2018;14 (1) :98-119. |[4]Momcilovic O, et al. Derivation, Characterization, and Neural Differentiation of Integration-Free Induced Pluripotent Stem Cell Lines from Parkinson's Disease Patients Carrying SNCA, LRRK2, PARK2, and GBA Mutations. PLoS One. 2016 May 18;11 (5) :e0154890.
  • Shipping Conditions:

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions:

    Stored at -20°C for 2 years
  • Scientific Category:

    Recombinant Proteins