SNCA, Human

CAT: 0804-HY-P70577-01Size: 5 µgDry Ice: NoHazardous: No
CAT#:0804-HY-P70577-01Size:5 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
SNCA Protein is a protein abnormally aggregated to form Lewy bodies. SNCA Protein causes neuronal differentiation and maturation disorders, inhibits neurite outgrowth, reduces neuronal electrical activity through increased gene copy number (such as triploidy) or mutation, and promotes the release of extracellular toxic particles (such as oligomers) by interfering with the autophagy-lysosomal pathway (ALP), thereby inducing inflammatory responses and damage to neighboring cells. SNCA Protein, Human is a recombinant SNCA protein expressed by E. coli without a tag.
Product Name Alternative
SNCA Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/snca-protein-human.html
Purity
97.00
Smiles
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Molecular Formula
6622 (Gene_ID) P37840-1 (M1-A140) (Accession)
Molecular Weight
Approximately 18.0 kDa
References & Citations
[1]Oliveira LM, et al. Elevated α-synuclein caused by SNCA gene triplication impairs neuronal differentiation and maturation in Parkinson's patient-derived induced pluripotent stem cells. Cell Death Dis. 2015 Nov 26;6 (11) :e1994.|[2]Poehler AM, et al. Autophagy modulates SNCA/α-synuclein release, thereby generating a hostile microenvironment. Autophagy. 2014;10 (12) :2171-92.|[3]Minakaki G, et al. Autophagy inhibition promotes SNCA/alpha-synuclein release and transfer via extracellular vesicles with a hybrid autophagosome-exosome-like phenotype. Autophagy. 2018;14 (1) :98-119. |[4]Momcilovic O, et al. Derivation, Characterization, and Neural Differentiation of Integration-Free Induced Pluripotent Stem Cell Lines from Parkinson's Disease Patients Carrying SNCA, LRRK2, PARK2, and GBA Mutations. PLoS One. 2016 May 18;11 (5) :e0154890.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P70660-01SNCA, Mouse
HY-P704894SNCA Pre-formed Fibrils , Human
HY-P704896SNCA, Mouse (His)
HY-P705391SNCA, Cynomolgus (His)
HY-P704893SNCA Pre-formed Fibrils , Human (His)
HY-P704895SNCA Pre-formed Fibrils, Human (A53T, His)
HY-RS13484Snca Rat Pre-designed siRNA Set A
HY-RS13483Snca Mouse Pre-designed siRNA Set A
HY-P71043-01SNCG, Human
HY-P702985-01SNCB, Human (His)

Alternative Products

CatalogName
OM306211-01SNCA Human
RPF11289-01Recombinant Human SNCA
44541052SNCA Adenovirus (Human)
KMPH3480-01Human SNCA Protein
abx905175-01Human SNCA siRNA
CRH4505-01SNCA siRNA (Human)
OM306209-01SNCA A53T Human
32-13440-10SNCA E46K, Human
E55A13598Human SNCA Antibody
OM306205-01SNCA NACP112 Human

Popular Products