Products for Research Use Only
RegisterLogin

IL-15, Human

CAT: 0804-HY-P7034-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7034-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IL-15 Protein, Human modulates immune cells of both the innate and adaptive immune systems, induces the production of chemokines and cytokines, stimulates the proliferation of natural killer cells, T-cells and B-cells. IL-15 Protein, Human triggers both pro-inflammatory and protective immune responses. IL-15 Protein, Human is the recombinant human-derived IL-15 Protein, expressed by E. coli.
Product Name Alternative
IL-15 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-15-protein-human.html
Purity
98.0
Smiles
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Molecular Formula
3600 (Gene_ID) P40933-1 (N49-S162) (Accession)
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Conlon KC, et al. Redistribution, hyperproliferation, activation of natural killer cells and CD8 T cells, and cytokine production during first-in-human clinical trial of recombinant human interleukin-15 in patients with cancer. J Clin Oncol. 2015 Jan 1;33 (1) :74-82.|[2]Sun W, et al. High level expression and purification of active recombinant human interleukin-15 in Pichiapastoris. J Immunol Methods. 2016 Jan;428:50-7.|[3]O'Leary MF, et al., IL-15 promotes human myogenesis and mitigates the detrimental effects of TNFα on myotube development. Sci Rep. 2017 Oct 11;7 (1) :12997.|[4]Perera L P, et al., IL-15 induces the expression of chemokines and their receptors in T lymphocytes[J]. The Journal of Immunology, 1999, 162 (5) : 2606-2612.|[5]Waldmann TA, et al., Safety (toxicity), pharmacokinetics, immunogenicity, and impact on elements of the normal immune system of recombinant human IL-15 in rhesus macaques. Blood. 2011 May 5;117 (18) :4787-95.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P704539-01IL-15, Rat
HY-102049-01IL-15-IN-1
HY-P77700IL-15R alpha & IL-15 Protein, Human (Biotinylated, HEK293, His)
HY-P87543IL-15 Antibody (YA7227, Rabbit)
HY-P78719-01IL-15, Mouse (HEK293, Fc)
HY-P990446-01Anti-IL-15 Antibody (DISC0280)
HY-P78558-01IL-15R alpha & IL-15, Mouse (HEK293, His)
HY-P700193AF-01Animal-Free IL-15, Mouse (His)
HY-P704694IL-15, Rhesus macaque (HEK293, His)
HY-P700245AF-01Animal-Free IL-15, Pig (His)

Alternative Products

CatalogName
MBS691697-01Human IL-15
E34M016HIL-15, Human
OM296728-01IL 15 Human
SR117-0100Interleukin-15 (IL-15), Human
GWB-31E065Interleukin-15 (IL-15) Human
RC212-26IL-15, Interleukin-15, human
MBS651064-01Interleukin 15, Recombinant, Human (IL-15)
32-7014-50Recombinant Human Interleukin-15/IL-15
Y02701-01IL-15

Popular Products