EIF1, Human (GST)

• Description :

  The EIF1 protein is a key member of the 43S preinitiation complex (43S PIC), binding to the mRNA cap-proximal region, scanning the 5′-untranslated region, and localizing the initiation codon. EIF1 Protein, Human (GST) is the recombinant human-derived EIF1 protein, expressed by E. coli , with N-GST labeled tag.

• Product Name Alternative :

  EIF1 Protein, Human (GST), Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/eif1-protein-human-gst.html

• Smiles :

  MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF

• Molecular Formula :

  10209 (Gene_ID) P41567 (M1-F113) (Accession)

• Molecular Weight :

  39.7 kDa

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Scientific Category :

  Recombinant Proteins