Products for Research Use Only
RegisterLogin

Bone Morphogenetic Protein 4, BMP4

CAT: 0013-GTR19145288-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19145288-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant mature human BMP4 is produced in HEK293 cells using stable mammalian expression. This tag-free, liquid-formulated, research-grade protein is purified through a gentle mixed-mode chromatography process designed to preserve its native structure and biological activity. It is suitable for stem cell differentiation, developmental biology, organoid workflows, lineage specification, and media development applications. (Tested applications: Functional studies, ImmunoAssay, Western Blot.)
Product Name Alternative
Bone Morphogenetic Protein 4, BMP4, BMP-4, BMP2B, BMP-2B, ZYME, DVR4
UniProt
P12644
Expression Region
293-408 aa
Tag
No tag
Origin
Human
Field of Research
Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research
Purity
>95%
Form
Liquid (Sterile-filtered)
Molecular Weight
13 kDa
Storage Conditions
4°C for short-term and -70°/80°C long-term
Notes
For research use only.
Applications Notes
Biologically active and independently validated against human BMP4 from R&D Systems in two differentiation models. 1. In a cardiac differentiation model, Daresbury BMP4 supported beating embryoid body formation and NKX2.5-GFP expression at 11 ng/mL, compared with 25 ng/mL for the commercial reference under the reported conditions. 2. In day-5 trophoblast differentiation of MAN13 hESCs at 10 ng/mL, this product induced CDX2, GATA3, KRT7, and TFAP2A expression by 1540-, 2350-, 7.69-, and 4542-fold, respectively, relative to the untreated control (= 1) . These responses corresponded to approximately 90%, 122%, 88%, and 88% of the R&D Systems reference response, respectively.
Tested Applications
FA, WB
Preservative
20mM histidine pH 5.5, 0.2M NaCl, 0.6M arginine
AA Sequence
SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Related Products

CatalogName
GTR18875922-01Simian BMP4 (Bone Morphogenetic Protein 4) ELISA Kit
GTR18843220Bovine BMP4/Bone morphogenetic protein 4 ELISA Kit
GTR18875742-01Mouse BMP4 (Bone Morphogenetic Protein 4) ELISA Kit
GTR18843219Chicken BMP4/Bone morphogenetic protein 4 ELISA Kit
GTR18843218Rat Bmp4/Bone morphogenetic protein 4 ELISA Kit
GTR18873556-01Mouse BMP4 (Bone Morphogenetic Protein 4) Microsample ELISA Kit
GTR18871893-01Human BMP4 (Bone Morphogenetic Protein 4) Microsample ELISA Kit
GTR18872179-01Rat BMP4 (Bone Morphogenetic Protein 4) Microsample ELISA Kit
GTR19018509-01Bone morphogenetic protein 4
GTR19018476-01Bone morphogenetic protein 4

Alternative Products

CatalogName
030812BMP4 (BMP4, BMP2B, DVR4, Bone morphogenetic protein 4, Bone morphogenetic protein 2B)
029996BMP4 (Bone morphogenetic protein 4)
308097-01Bone Morphogenetic Protein 4 (BMP4)
030812-PEBMP4 (BMP4, BMP2B, DVR4, Bone morphogenetic protein 4, Bone morphogenetic protein 2B) (PE) discontinued
030812-HRPBMP4 (BMP4, BMP2B, DVR4, Bone morphogenetic protein 4, Bone morphogenetic protein 2B) (HRP) discontinued
030812-FITCBMP4 (BMP4, BMP2B, DVR4, Bone morphogenetic protein 4, Bone morphogenetic protein 2B) (FITC) discontinued
030812-APCBMP4 (BMP4, BMP2B, DVR4, Bone morphogenetic protein 4, Bone morphogenetic protein 2B) (APC) discontinued
030812-APBMP4 (BMP4, BMP2B, DVR4, Bone morphogenetic protein 4, Bone morphogenetic protein 2B) (AP) discontinued
030812-BiotinBMP4 (BMP4, BMP2B, DVR4, Bone morphogenetic protein 4, Bone morphogenetic protein 2B) (Biotin) discontinued
TRV-039105-01Recombinant Bone Morphogenetic Protein 4 (BMP4)

Popular Products