Products for Research Use Only
RegisterLogin

Recombinant Human Interferon lambda-4 (IFNL4)

CAT: 0013-GTR19130031-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19130031-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Recombinant Human Interferon lambda-4 (IFNL4) spans the amino acid sequence from region 22-179. Purity: Greater than 85% as determined by SDS-PAGE.
Product Name Alternative
Interferon lambda-4; IFN-lambda-4; IFNL4
UniProt
K9M1U5
Expression Region
22-179
Origin
Homo sapiens (Human)
Field of Research
Infectious Disease & Virology; Immunology & Inflammation
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
AAPRRCLLSHYRSLEPRTLAAAKALRDRYEEEALSWGQRNCSFRPRRDPPRPSSCARLRHVARGIADAQAVLSGLHRSELLPGAGPILELLAAAGRDVAACLELARPGSSRKVPGAQKRRHKPRRADSPRCRKASVVFNLLRLLTWELRLAAHSGPCL

Related Products

CatalogName
GTR18086912-01Rabbit polyclonal antibody to human Interferon lambda-4 (IFNL4)
GTR19014982-01Interferon lambda-4
GTR19025454-01Recombinant Human Interferon lambda-1 protein (IFNL1) (Active)
GTR19020051-01Interferon lambda-3
GTR19014967-01Interferon lambda-1
GTR19015453-01Interferon lambda-3
GTR18855801-01Bovine IFNL3 (Interferon lambda 3) ELISA Kit
GTR19319947-01IFNL4 siRNA (Human)
GTR18840141Human Interferon lambda-3 ELISA Kit
GTR19023567-01Recombinant Human Interferon α-4/IFNA4 (C-6His)

Alternative Products

CatalogName
abx300994-01Interferon Lambda-4 (IFNL4) Antibody
MBS2890589-01Human IFNL4/Interferon lambda-4 ELISA Kit
E7528Hu-01Human Interferon lambda-4, IFNL4 ELISA KIT
EK716122Human Interferon Lambda-4 (IFNL4) Elisa Kit
JOT-EK7528Hu-01Human Interferon lambda-4,IFNL4 ELISA KIT
R15306hHuman IFNL4 / Interferon lambda-4 Recombinant Protein
MBS643503-01IL28B, NT (IL28B, IFNL3, IFNL4, IL28C, ZCYTO22, Interleukin-28B, Cytokine Zcyto22, Interferon lambda-3, Interferon lambda-4, Interleukin-28C)
MBS6310189-01IL28B, NT (IL28B, IFNL3, IFNL4, IL28C, ZCYTO22, Interleukin-28B, Cytokine Zcyto22, Interferon lambda-3, Interferon lambda-4, Interleukin-28C) (PE)
MBS6310182-01IL28B, NT (IL28B, IFNL3, IFNL4, IL28C, ZCYTO22, Interleukin-28B, Cytokine Zcyto22, Interferon lambda-3, Interferon lambda-4, Interleukin-28C) (FITC)
MBS6310181-01IL28B, NT (IL28B, IFNL3, IFNL4, IL28C, ZCYTO22, Interleukin-28B, Cytokine Zcyto22, Interferon lambda-3, Interferon lambda-4, Interleukin-28C) (Biotin)

Popular Products