Products for Research Use Only
RegisterLogin

Recombinant Human Immunoglobulin lambda variable 2-18 (LV218)

CAT: 0013-GTR19129526-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19129526-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Recombinant Human Immunoglobulin lambda variable 2-18 (LV218) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.
Product Name Alternative
Immunoglobulin lambda variable 2-18 IGLV2-18
UniProt
A0A075B6J9
Expression Region
20-118
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
QSALTQPPSVSGSPGQSVTISCTGTSSDVGSYNRVSWYQQPPGTAPKLMIYEVSNRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSLYTSSSTF

Related Products

CatalogName
GTR19129533-01Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54)
GTR19129527-01Recombinant Human Immunoglobulin lambda variable 3-22 (LV322)
GTR19129521-01Recombinant Human Immunoglobulin lambda variable 3-9 (LV39)
GTR19129520-01Recombinant Human Immunoglobulin lambda variable 4-3 (LV403)
GTR19129473-01Recombinant Human Immunoglobulin lambda variable 5-52 (LV552)
GTR19129450-01Recombinant Human Immunoglobulin lambda variable 1-36 (LV136)
GTR19129439-01Recombinant Human Immunoglobulin lambda variable 9-49 (LV949)
GTR19127021-01Recombinant Human Immunoglobulin lambda variable 8-61 (LV861)
GTR19127005-01Recombinant Human Immunoglobulin lambda variable 4-3 (LV403)
GTR19133183-01Recombinant Human Immunoglobulin lambda variable 3-22 (LV322)

Alternative Products

CatalogName
E16286hELISA Kit For Immunoglobulin lambda variable 2-18
MBS2907267-01Human IGLV2-18/Immunoglobulin lambda variable 2-18 ELISA Kit
E16300hELISA Kit For Immunoglobulin lambda variable 2-11
E15672hELISA Kit For Immunoglobulin lambda variable 2-23
MBS2905405-01Human IGLV2-23 / Immunoglobulin lambda variable 2-23 ELISA Kit
E15879hELISA Kit For Immunoglobulin lambda variable 10-54
E15967hELISA Kit For Immunoglobulin lambda variable 3-1
E16212hELISA Kit For Immunoglobulin lambda variable 3-19
E16500hELISA Kit FOR Immunoglobulin lambda variable 7-43
E16119hELISA Kit For Immunoglobulin lambda variable 5-39

Popular Products