Products for Research Use Only
RegisterLogin

Recombinant Human PAT complex subunit Asterix (ASTER), partial

CAT: 0013-GTR19129619-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19129619-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Recombinant Human PAT complex subunit Asterix (ASTER), partial spans the amino acid sequence from region 2-32. Purity: Greater than 85% as determined by SDS-PAGE.
Product Name Alternative
PAT complex subunit Asterix; Protein associated with the ER translocon of 10kDa; PAT-10; PAT10; WD repeat domain 83 opposite strand; WDR83 opposite strand; WDR83OS C19orf56 CGI-140 My006 PTD008
UniProt
Q9Y284
Expression Region
2-32
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
STNNMSDPRRPNKVLRYKPPPSECNPALDDP

Related Products

CatalogName
GTR18795069Protein Aster-A Antibody
GTR19234082-01Aster-A Ligand-3
GTR19262272-01PROTAC Aster-A degrader-1
GTR18795066Protein Aster-A Antibody (Fluoro647)
GTR18795060Protein Aster-A Antibody (Fluoro550)
GTR18795058Protein Aster-A Antibody (Cy3)
GTR18795065Protein Aster-A Antibody (PE)
GTR18795064Protein Aster-A Antibody (APC)
GTR18795061Protein Aster-A Antibody (Fluoro594)
GTR18795063Protein Aster-A Antibody (HRP)

Alternative Products

CatalogName
MBS1284125Recombinant Aster yellows witches'-broom phytoplasma Protein translocase subunit SecA (secA), partial
MBS1382162Recombinant Aster yellows witches'-broom phytoplasma Phenylalanine--tRNA ligase beta subunit (pheT), partial
MBS1282449Recombinant Aster yellows witches'-broom phytoplasma DNA-directed RNA polymerase subunit beta (rpoB), partial
MBS1316605Recombinant Aster yellows witches'-broom phytoplasma DNA-directed RNA polymerase subunit beta'(rpoC), partial
MBS7099555Recombinant Manduca sexta Protein Asterix, partial
MBS7076008Recombinant Bovine Protein Asterix (WDR83OS), partial
MBS7087856Recombinant Mouse Protein Asterix (Wdr83os), partial
MBS7087401Recombinant Pig Protein Asterix (WDR83OS), partial
MBS7069721Recombinant Chicken Protein Asterix (WDR83OS), partial
MBS7102828Recombinant Drosophila melanogaster Protein Asterix (CG10674), partial

Popular Products