Recombinant Human T cell receptor alpha variable 40 (TVA40)

CAT: 0013-GTR19129408-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR19129408-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Recombinant Human T cell receptor alpha variable 40 (TVA40) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

UniProtKB · A0A0B4J280

T cell receptor alpha variable 40

TVA40_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: A0A0B4J280
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: TRAV40
Protein existence: 3: Inferred from homology
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: —

Protein keywords

Biological process

Adaptive immunityImmunity

Cellular component

Cell membraneMembraneT cell receptor

PTM

Disulfide bondGlycoprotein

Domain

Immunoglobulin domainSignal

Molecular function

Receptor

Technical term

Reference proteome

Related Products

Catalog	Name
GTR19133143-01	Recombinant Human T cell receptor alpha variable 30 (TVA30)
GTR19133086-01	Recombinant Human T cell receptor alpha variable 10 (TVA10)
GTR19133075-01	Recombinant Human T cell receptor alpha variable 41 (TVA41)
GTR19131836-01	Recombinant Human T cell receptor alpha variable 10 (TVA10)
GTR19130567-01	Recombinant Human T cell receptor alpha variable 41 (TVA41), Biotinylated
GTR19128160-01	Recombinant Human T cell receptor alpha variable 4 (TVA4), Biotinylated
GTR19129419-01	Recombinant Human T cell receptor alpha variable 41 (TVA41)
GTR19126971-01	Recombinant Human T cell receptor alpha variable 30 (TVA30)
GTR19133070-01	Recombinant Human T cell receptor alpha variable 20 (TVA20)
GTR19129487-01	Recombinant Human T cell receptor alpha variable 30 (TVA30)

Alternative Products

Catalog	Name
361708	V alpha TCR (TCR Variable alpha Chain, T-cell Receptor Variable alpha Chain)
abx238955	T-Cell Receptor Alpha Variable 20 (TRAV20) Antibody
abx383912	Human T-Cell Receptor Alpha Variable 20 (TRAV20) ELISA Kit
PX-P4655-01	T cell receptor delta variable 1 (TRDV1)
abx376627-01	T Cell Receptor Delta Variable 2 (TRDV2) Antibody
abx456902-01	T Cell Receptor Gamma Variable 9 (TRGV9) Antibody
abx421031-01	T Cell Receptor Delta Variable 1 (TRDV1) Antibody
abx421004-01	T Cell Receptor Gamma, Variable 3 (TRGV3) Antibody
MBS9020539-01	Recombinant Human T cell receptor beta variable 19 (TRBV19)
abx421038-01	T Cell Receptor Beta Variable 12-3 (TRBV12-3) Antibody