Products for Research Use Only
RegisterLogin

Recombinant Human Epithelial cell-transforming sequence 2 oncogene-like (ECT2L), partial

CAT: 0013-GTR19126706-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19126706-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Recombinant Human Epithelial cell-transforming sequence 2 oncogene-like (ECT2L), partial spans the amino acid sequence from region 566-754. Purity: Greater than 85% as determined by SDS-PAGE.
Product Name Alternative
Epithelial cell-transforming sequence 2 oncogene-like; Lung-specific F-box and DH domain-containing protein; Putative guanine nucleotide exchange factor LFDH; ECT2L C6orf91 LFDH
UniProt
Q008S8
Expression Region
566-754
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
KRARVVRELLQSERKYVQILEIVRDVYVAPLKAALSSNRAILSAANIQIIFCDILQILSLNRQFLDNLRDRLQEWGPAHCVGEIVTKFGSQLNTYTNFFNNYPVILKTIEKCREMIPAFRTFLKRHDKTIVTKMLSLPELLLYPSRRFEEYLNLLYAVRLHTPAEHVDRGDLTTAIDQIKKYKGYIDQM

Related Products

CatalogName
GTR18235863-01ECT2L Antibody
GTR19337949-01ECT2L siRNA (Human)
GTR19024975-01Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial
GTR19122616-01Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial
GTR19123704-01Recombinant Human Epithelial membrane protein 2 (EMP2), partial
GTR18894163-01Recombinant Mouse Epithelial cell adhesion molecule (Epcam), partial
GTR18893769-01Recombinant Mouse Epithelial cell adhesion molecule (Epcam), partial
GTR19027049-01Recombinant Human Transforming protein RhoA (RHOA), partial
GTR18319719-01ECT2L Rabbit Polyclonal Antibody
GTR18978281ECT2L Antibody Blocking peptide

Alternative Products

CatalogName
abx521511Human Epithelial cell-transforming sequence 2 oncogene-like (ECT2L) ELISA Kit
MBS9317844-01Human Epithelial cell-transforming sequence 2 oncogene-like, ECT2L ELISA Kit
D2200Epithelial cell-transforming sequence 2 oncogene-Like (ECT2L) Human ELISA Kit
034910ECT2L, CT (ECT2L, C6orf91, LFDH, Epithelial cell-transforming sequence 2 oncogene-like, Lung-specific F-box and DH domain-containing protein, Putative guanine nucleotide exchange factor LFDH)
MBS6294304-01ECT2L, CT (ECT2L, C6orf91, LFDH, Epithelial cell-transforming sequence 2 oncogene-like, Lung-specific F-box and DH domain-containing protein, Putative guanine nucleotide exchange factor LFDH) (Biotin)
MBS6294303-01ECT2L, CT (ECT2L, C6orf91, LFDH, Epithelial cell-transforming sequence 2 oncogene-like, Lung-specific F-box and DH domain-containing protein, Putative guanine nucleotide exchange factor LFDH) (APC)
MBS6294302-01ECT2L, CT (ECT2L, C6orf91, LFDH, Epithelial cell-transforming sequence 2 oncogene-like, Lung-specific F-box and DH domain-containing protein, Putative guanine nucleotide exchange factor LFDH) (AP)
MBS6294312-01ECT2L, CT (ECT2L, C6orf91, LFDH, Epithelial cell-transforming sequence 2 oncogene-like, Lung-specific F-box and DH domain-containing protein, Putative guanine nucleotide exchange factor LFDH) (PE)
MBS6294305-01ECT2L, CT (ECT2L, C6orf91, LFDH, Epithelial cell-transforming sequence 2 oncogene-like, Lung-specific F-box and DH domain-containing protein, Putative guanine nucleotide exchange factor LFDH) (FITC)
MBS6294307-01ECT2L, CT (ECT2L, C6orf91, LFDH, Epithelial cell-transforming sequence 2 oncogene-like, Lung-specific F-box and DH domain-containing protein, Putative guanine nucleotide exchange factor LFDH) (MaxLight 405)

Popular Products