Recombinant ATP synthase subunit b (atpF)

CAT: 0013-GTR19106909-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR19106909-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q663Q4

Expression Region

1-156

Origin

Yersinia pseudotuberculosis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQAN ATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREEL RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL

UniProtKB · Q663Q4

ATP synthase subunit b

ATPF_YERPS · Yersinia pseudotuberculosis serotype I (strain IP32953)

View on UniProt ↗

Primary accession: Q663Q4
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: atpF
Protein existence: 3: Inferred from homology
Organism: Yersinia pseudotuberculosis serotype I (strain IP32953)
Taxonomy ID: 273123
Alternative names: —
EC number: —
Processing: —
Secondary accessions: —

Protein keywords

Biological process

ATP synthesisHydrogen ion transportIon transportTransport

Cellular component

Cell inner membraneCell membraneCF(0)Membrane

Technical term

Reference proteome

Domain

TransmembraneTransmembrane helix

Related Products

Catalog	Name
GTR19106338-01	Recombinant ATP synthase subunit b, chloroplastic (atpF)
GTR19106003-01	Recombinant ATP synthase subunit b, chloroplastic (atpF)
GTR19105979-01	Recombinant ATP synthase subunit b, chloroplastic (atpF)
GTR19105837-01	Recombinant ATP synthase subunit b, chloroplastic (atpF)
GTR19105802-01	Recombinant ATP synthase subunit b, chloroplastic (atpF)
GTR19105890-01	Recombinant ATP synthase subunit b, chloroplastic (atpF)
GTR19105650-01	Recombinant ATP synthase subunit b, chloroplastic (atpF)
GTR19105461-01	Recombinant ATP synthase subunit b, chloroplastic (atpF)
GTR19105330-01	Recombinant ATP synthase subunit b, chloroplastic (atpF)
GTR19105903-01	Recombinant ATP synthase subunit b, chloroplastic (atpF)

Alternative Products

Catalog	Name
MBS1207311-01	Recombinant ATP synthase subunit b (atpF)