Recombinant Uncharacterized protein Mb0489c (Mb0489c)

CAT: 0013-GTR19102057-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR19102057-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Recombinant Uncharacterized protein Mb0489c (Mb0489c) spans the amino acid sequence from region 1-348.

Product Name Alternative

Uncharacterized protein Mb0489c

UniProt

P64700

Expression Region

1-348

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNPQGPPNDPSPWARPGDQGPLARPPASSEASTGRLRPGEPAGHIQEPVSPPTQPEQQP QTEHLAASHAHTRRSGRQAAHQAWDPTGLLAAQEEEPAAVKTKRRARRDPLTVFLVLIIV FSLVLAGLIGGELYARHVANSKVAQAVACVVKDQATASFGVAPLLLWQVATRHFTNISVE TAGNQIRDAKGMQIKLTIQNVRLKNTPNSRGTIGALDATITWSSEGIKESVQNAIPILGA FVTSSVVTHPADGTVELKGLLNNITAKPIVAGKGLELQIINFNTLGFSLPKETVQSTLNE FTSSLTKNYPLGIHADSVQVTSTGVVSRFSTRDAAIPTGIQNPCFSHI

UniProtKB · P64700

Uncharacterized protein Mb0489c

Y489_MYCBO · Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

View on UniProt ↗

Primary accession: P64700
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: —
Protein existence: 4: Predicted
Organism: Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Taxonomy ID: 233413
Alternative names: —
EC number: —
Processing: —
Secondary accessions: A0A1R3XVK5, Q11145, X2BF60

Protein keywords

Cellular component

Cell membraneMembrane

Technical term

Reference proteome

Domain

TransmembraneTransmembrane helix

Related Products

Catalog	Name
GTR19100950-01	Recombinant Uncharacterized protein Mb0898c (Mb0898c)
GTR19112712-01	Recombinant Uncharacterized protein Mb0486 (Mb0486)
GTR19089905-01	Recombinant Uncharacterized protein ORF2
GTR19026384-01	Recombinant Uncharacterized protein (CE2118)
GTR19100299-01	Recombinant Putative L, D-transpeptidase Mb0493 (Mb0493)
GTR19094280-01	Recombinant Putative amino-acid transporter Mb0498 (Mb0498)
GTR19087483-01	Recombinant Uncharacterized protein Mb1372 (Mb1372)
GTR19086443-01	Recombinant Uncharacterized protein ycf92 (ycf92)
GTR19083874-01	Recombinant Uncharacterized protein Mb0088 (Mb0088)
GTR19064542-01	Recombinant Cricetulus griseus Uncharacterized protein

Alternative Products

Catalog	Name
MBS7040956-01	Recombinant Uncharacterized protein Mb0489c (Mb0489c)
MBS7062098	Recombinant Mycobacterium bovis Uncharacterized protein Mb0489c (Mb0489c), partial
580838-01	Uncharacterized Protein
MBS7042379-01	Uncharacterized protein C21orf63
MBS7042374-01	Uncharacterized protein C18orf1
A49463-100UL	Uncharacterized protein Antibody
AP84527-01	Uncharacterized protein KIAA1377
339078-01	Uncharacterized Protein C4orf3
580840-01	Uncharacterized Protein (FITC)
MBS7043597-01	Uncharacterized protein slr1128