Recombinant Polypterus sp. Cytochrome b (mt-cyb)

CAT: 0013-GTR19110383-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR19110383-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Recombinant Polypterus sp. Cytochrome b (mt-cyb) spans the amino acid sequence from region 1-100.

Product Name Alternative

Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

UniProt

P29669

Expression Region

1-100

Origin

Polypterus sp. (Bichir)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSLLGLCLIVQIITGLFLAMHYVSDISSAFSSVAHICRDVNYGWLIRNFHANGASLFFI CIYLHIARGLYYGSYLYMETWNIGVILLLLTMMTAFVGYV

UniProtKB · P29669

Cytochrome b

CYB_POLSX · Polypterus sp.

View on UniProt ↗

Primary accession: P29669
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: mt-cyb
Protein existence: 3: Inferred from homology
Organism: Polypterus sp. (Bichir)
Taxonomy ID: 8291
Alternative names: —
EC number: —
Processing: Fragment
Secondary accessions: —

Protein keywords

Biological process

Electron transportRespiratory chainTransport

Ligand

HemeIronMetal-bindingUbiquinone

Cellular component

MembraneMitochondrionMitochondrion inner membrane

Domain

TransmembraneTransmembrane helix

Related Products

Catalog	Name
GTR19082497-01	Recombinant Cytochrome b (MT-CYB)
GTR19094830-01	Recombinant Polypterus sp. Cytochrome c oxidase subunit 1 (mt-co1)
GTR19112067-01	Recombinant Cichlasoma centrarchus Cytochrome b (mt-cyb)
GTR19112066-01	Recombinant Cichlasoma labiatum Cytochrome b (mt-cyb)
GTR19112065-01	Recombinant Dipodomys heermanni Cytochrome b (MT-CYB)
GTR19112060-01	Recombinant Dipodomys californicus Cytochrome b (MT-CYB)
GTR19112059-01	Recombinant Cichlasoma nicaraguense Cytochrome b (mt-cyb)
GTR19111098-01	Recombinant Gomphosus varius Cytochrome b (mt-cyb)
GTR19110579-01	Recombinant Scaphirhynchus platorynchus Cytochrome b (mt-cyb)
GTR19108189-01	Recombinant Canis simensis Cytochrome b (MT-CYB)

Alternative Products

Catalog	Name
MBS1235340	Recombinant Polypterus sp. Cytochrome b (mt-cyb)
MBS7056108	Recombinant Polypterus sp. Cytochrome b (mt-cyb), partial
MBS7096089	Recombinant Polypterus ornatipinnis Cytochrome b (mt-cyb), partial
MBS1006927	Recombinant Cytochrome b (MT-CYB)
AP2C460-01	Recombinant Chicken Cytochrome b (MT-CYB)
AP2C116-01	Recombinant Feline Cytochrome b (MT-CYB)
MBS7101580	Recombinant Cytochrome b (MT-CYB), partial
MBS7021817-01	Recombinant Plethodon yonahlossee Cytochrome b (mt-cyb)
MBS7021816-01	Recombinant Platyrrhinus helleri Cytochrome b (MT-CYB)
MBS7021831-01	Recombinant Tomopeas ravus Cytochrome b (MT-CYB)