Recombinant Potassium-transporting ATPase C chain (kdpC)

CAT: 0013-GTR19104459-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR19104459-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Recombinant Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-222.

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

Q82PI5

Expression Region

1-222

Origin

Streptomyces avermitilis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNSVTNTARLLWAGLRSLLVLTVVTGVLYPLAVTGVAQGLFSDQANGSEIKADGKVVGS SLIGQAYNLPLKKGQETPEPDLKWFQGRPANGLGTNSVNTQYSLILSGATNRSGDNADLI KWVKDAKAAVVKDNSTADHKVKPSDVPADAVTSSGSGLDPDISPEYADLQVHRIAEQNHL AVAPVQKLVDEHTDGRTLGFIGEPRVNVLELNIALKELVATS

UniProtKB · Q82PI5

Potassium-transporting ATPase KdpC subunit

KDPC_STRAW · Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)

View on UniProt ↗

Primary accession: Q82PI5
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: kdpC
Protein existence: 3: Inferred from homology
Organism: Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Taxonomy ID: 227882
Alternative names: —
EC number: —
Processing: —
Secondary accessions: —

Protein keywords

Ligand

ATP-bindingNucleotide-bindingPotassium

Cellular component

Cell membraneMembrane

Biological process

Ion transportPotassium transportTransport

Technical term

Reference proteome

Domain

TransmembraneTransmembrane helix

Related Products

Catalog	Name
GTR19106212-01	Recombinant Rhodobacter sphaeroides Potassium-transporting ATPase C chain (kdpC)
GTR19105656-01	Recombinant Pseudomonas putida Potassium-transporting ATPase C chain (kdpC)
GTR19105481-01	Recombinant Staphylococcus aureus Potassium-transporting ATPase C chain (kdpC)
GTR19105464-01	Recombinant Staphylococcus aureus Potassium-transporting ATPase C chain (kdpC)
GTR19105449-01	Recombinant Parvibaculum lavamentivorans Potassium-transporting ATPase C chain (kdpC)
GTR19105431-01	Recombinant Pseudomonas entomophila Potassium-transporting ATPase C chain (kdpC)
GTR19105408-01	Recombinant Azorhizobium caulinodans Potassium-transporting ATPase C chain (kdpC)
GTR19105324-01	Recombinant Microcystis aeruginosa Potassium-transporting ATPase C chain (kdpC)
GTR19105307-01	Recombinant Ochrobactrum anthropi Potassium-transporting ATPase C chain (kdpC)
GTR19105306-01	Recombinant Cronobacter sakazakii Potassium-transporting ATPase C chain (kdpC)

Alternative Products

Catalog	Name
MBS7018050-01	Recombinant Potassium-transporting ATPase C chain (kdpC)
MBS7018094-01	Recombinant Streptomyces coelicolor Potassium-transporting ATPase C chain (kdpC)
MBS7018085-01	Recombinant Sorangium cellulosum Potassium-transporting ATPase C chain (kdpC)
MBS7018079-01	Recombinant Shewanella putrefaciens Potassium-transporting ATPase C chain (kdpC)
MBS7018074-01	Recombinant Salmonella heidelberg Potassium-transporting ATPase C chain (kdpC)
MBS7018042-01	Recombinant Ochrobactrum anthropi Potassium-transporting ATPase C chain (kdpC)
MBS7018027-01	Recombinant Janthinobacterium sp. Potassium-transporting ATPase C chain (kdpC)
MBS7018024-01	Recombinant Gloeobacter violaceus Potassium-transporting ATPase C chain (kdpC)
MBS7018003-01	Recombinant Deinococcus radiodurans Potassium-transporting ATPase C chain (kdpC)
MBS7018002-01	Recombinant Dechloromonas aromatica Potassium-transporting ATPase C chain (kdpC)