Recombinant Pyrococcus furiosus Digeranylgeranylglyceryl phosphate synthase (PF1963)

CAT: 0013-GTR19082986-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR19082986-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Recombinant Pyrococcus furiosus Digeranylgeranylglyceryl phosphate synthase (PF1963) spans the amino acid sequence from region 1-277.

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

Q8TZM7

Expression Region

1-277

Origin

Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVKGFIEIMRPHNCILAGIVGILGALVAYEGIPDIKTLTLIFWVVYFGCSGGNTANDYF DYEIDKINRPNRPLPRGAMSRRAALYYALLQYAIGSILAYFLNIRAFVFATIAYFLTFLY GWKLKPLPLVGNITVAALTAATPIYGAIGVGRIGLAGYLAICAFLVNVSREIMKDIEDIE GDKALGARTLPIIIGEKKAAIIAAIFGFLTVIASFLPVKVGIGLGYAPIIIVDIIIIKAS IDVLRDPKAASKGQKLLKIATFVAVISFLAGALTKGV

UniProtKB · Q8TZM7

Digeranylgeranylglyceryl phosphate synthase

DGGGP_PYRFU · Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

View on UniProt ↗

Primary accession: Q8TZM7
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: —
Protein existence: 3: Inferred from homology
Organism: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Taxonomy ID: 186497
Alternative names: DGGGP synthase, DGGGPS
EC number: 2.5.1.42
Processing: —
Secondary accessions: —

Protein keywords

Cellular component

Cell membraneMembrane

Biological process

Lipid biosynthesisLipid metabolismPhospholipid biosynthesisPhospholipid metabolism

Ligand

Magnesium

Technical term

Reference proteome

Molecular function

Transferase

Domain

TransmembraneTransmembrane helix

Related Products

Catalog	Name
GTR19082982-01	Recombinant Pyrococcus abyssi Digeranylgeranylglyceryl phosphate synthase (PYRAB00300)
GTR19087641-01	Recombinant Pyrococcus furiosus Cobalamin synthase (cobS)
GTR19083032-01	Recombinant Thermococcus onnurineus Digeranylgeranylglyceryl phosphate synthase (TON_1950)
GTR19082850-01	Recombinant Thermofilum pendens Digeranylgeranylglyceryl phosphate synthase (Tpen_1449)
GTR19082447-01	Recombinant Ignicoccus hospitalis Digeranylgeranylglyceryl phosphate synthase (Igni_0416)
GTR19101693-01	Recombinant Pyrococcus furiosus UPF0252 protein PF1496 (PF1496)
GTR19087179-01	Recombinant Methanoculleus marisnigri Digeranylgeranylglyceryl phosphate synthase (Memar_1697)
GTR19091947-01	Recombinant Halobacterium salinarum Digeranylgeranylglyceryl phosphate synthase (OE1921R)
GTR19091818-01	Recombinant Korarchaeum cryptofilum Digeranylgeranylglyceryl phosphate synthase (Kcr_1480)
GTR19083348-01	Recombinant Methanosaeta thermophila Digeranylgeranylglyceryl phosphate synthase (Mthe_1142)

Alternative Products

Catalog	Name
MBS7039470-01	Recombinant Pyrococcus furiosus Digeranylgeranylglyceryl phosphate synthase (PF1963)
MBS7093932	Recombinant Pyrococcus furiosus Digeranylgeranylglyceryl phosphate synthase (PF1963), partial
MBS1257948	Recombinant Methanococcus maripaludis Digeranylgeranylglyceryl phosphate synthase (MmarC6_0995)
MBS1068966	Recombinant Ignicoccus hospitalis Digeranylgeranylglyceryl phosphate synthase (Igni_0416)
MBS1158759	Recombinant Thermofilum pendens Digeranylgeranylglyceryl phosphate synthase (Tpen_1449)
MBS7040797-01	Recombinant Thermococcus onnurineus Digeranylgeranylglyceryl phosphate synthase (TON_1950)
MBS7038604-01	Recombinant Methanococcus vannielii Digeranylgeranylglyceryl phosphate synthase (Mevan_0977)
MBS1249118-01	Recombinant Methanothermobacter thermautotrophicus Digeranylgeranylglyceryl phosphate synthase (MTH_1098)
MBS1002441	Recombinant Halobacterium salinarum Digeranylgeranylglyceryl phosphate synthase (OE1921R)
MBS1160459	Recombinant Methanosaeta thermophila Digeranylgeranylglyceryl phosphate synthase (Mthe_1142)