Recombinant Fusobacterium nucleatum subsp. nucleatum Cobalamin synthase (cobS)

CAT: 0013-GTR19082960-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR19082960-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Recombinant Fusobacterium nucleatum subsp. nucleatum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-278.

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8R666

Expression Region

1-278

Origin

Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGFLLLLSFMTRIPMPKTDYDEEKLGKSMKYFPVVGIIVGFILLFFCIIFNFILKNISY SAVLPLMIIVVILTDLITTGALHLDGLADTFDGIFSYRSKHKMLEIMKDSRLGSNGALAL ILYFLLKFILLFSLTIESREAAVYAIITYPVVSRFCSVVSCASSPYARGSGMGKTFVDNI KTCGLIVATVITLLYTIGMLFMPFILFTNYSLPMQFMIRSVLIIVIIVGLLALFAFAFSK LIERKIGGITGDTLGALLEISSLVYIFLFLVIPTFFIG

UniProtKB · Q8R666

Adenosylcobinamide-GDP ribazoletransferase

COBS_FUSNN · Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)

View on UniProt ↗

Primary accession: Q8R666
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: cobS
Protein existence: 3: Inferred from homology
Organism: Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Taxonomy ID: 190304
Alternative names: —
EC number: 2.7.8.26
Processing: —
Secondary accessions: —

Protein keywords

Cellular component

Cell inner membraneCell membraneMembrane

Biological process

Cobalamin biosynthesis

Ligand

Magnesium

Molecular function

Transferase

Domain

TransmembraneTransmembrane helix

Related Products

Catalog	Name
GTR19111347-01	Recombinant Fusobacterium nucleatum subsp. nucleatum ATP synthase subunit c (atpE)
GTR19095790-01	Recombinant Fusobacterium nucleatum subsp. nucleatum Lipoprotein signal peptidase (lspA)
GTR19102396-01	Recombinant Fusobacterium nucleatum subsp. nucleatum Protease HtpX homolog (htpX)
GTR19082762-01	Recombinant Fusobacterium nucleatum subsp. nucleatum Prolipoprotein diacylglyceryl transferase (lgt)
GTR19088383-01	Recombinant Fusobacterium nucleatum subsp. nucleatum Glycerol-3-phosphate acyltransferase (plsY)
GTR19107614-01	Recombinant Fusobacterium nucleatum subsp. nucleatum Large-conductance mechanosensitive channel (mscL)
GTR19088556-01	Recombinant Fusobacterium nucleatum subsp. nucleatum UPF0059 membrane protein FN1615 (FN1615)
GTR19101686-01	Recombinant Fusobacterium nucleatum subsp. nucleatum Putative zinc metalloprotease FN1322 (FN1322)
GTR19104777-01	Recombinant Fusobacterium nucleatum subsp. nucleatum Membrane protein insertase YidC (yidC)
GTR19083643-01	Recombinant Cobalamin synthase (cobS)

Alternative Products

Catalog	Name
MBS7012089-01	Recombinant Fusobacterium nucleatum subsp. nucleatum Cobalamin synthase (cobS)
MBS7093888	Recombinant Fusobacterium nucleatum subsp.nucleatum Cobalamin synthase (cobS), partial
MBS7012063-01	Recombinant Cobalamin synthase (cobS)
MBS7012087-01	Recombinant Fervidobacterium nodosum Cobalamin synthase (cobS)
MBS7012143-01	Recombinant Pseudomonas putida Cobalamin synthase (cobS)
MBS7012065-01	Recombinant Desulfitobacterium hafniense Cobalamin synthase (cobS)
MBS7012044-01	Recombinant Clostridium kluyveri Cobalamin synthase (cobS)
MBS7012035-01	Recombinant Clostridium botulinum Cobalamin synthase (cobS)
MBS7012033-01	Recombinant Clostridium beijerinckii Cobalamin synthase (cobS)
MBS7012032-01	Recombinant Clostridium acetobutylicum Cobalamin synthase (cobS)