PTH (1-31) amide (human)

CAT: 0013-GTR19068096-01Size: 250 mgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR19068096-01Size:250 mg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

PTH (1-31) amide (human) is a PTH analog.pTH (1-31) amide (human) stimulate phosphatidylcholine hydrolysis and stimulates adenylyl cyclase release.

Purity

≥95%

Molecular Weight

3940.35

Notes

For research use only.

AA Sequence

SVSEIQLMHNGKHLNSMERVEWLRKKLQDV-NH2

Related Products

Catalog	Name
GTR19035860-01	Human PTH- (1-31) amide
GTR19068116-01	PTH (1-31) (human)
GTR19035861-01	Human PTH- (1-31)
GTR19068040-01	PTH (1-34) amide (human)
GTR18900982-01	[Nle8, 21, Tyr34]-pTH (1-34) amide
GTR18899197-01	Bovine [Tyr34] PTH amide peptide
GTR19035103-01	PTH-Related Protein (1-34) amide (human, mouse, rat)
GTR19068231-01	[Nle8’21, Tyr34]-pTH (1-34) amide (rat)
GTR19068059-01	(Nle8·18, Tyr34) -pTH (1-34) amide (bovine)
GTR19067818-01	(Tyr36) -pTH-Related Protein (1-36) amide (chicken)

Catalog	Name
4026647.1	pTH (1-31) amide (human)
T76657L-01	Human PTH- (1-31) amide
MBS5818584	Human PTH-(1-31) amide
PTH-4324-V	Parathyroid Hormone (Human, 1-31 Amide)
P3109-24A	Parathyroid Hormone (PTH) (1-31) amide (human)
H-4058.0500	(Cyclo(Glu22-Lys26),Leu27)-pTH (1-31) amide (human)
FC109165-01	(Cyclo (Glu22-Lys26), Leu27) -pTH (1-31) amide (human)
CCP2363-01	GLP-1 amide (Human)
VAC-00290-01	Endothelin-1 (1-15), amide, human
CCP2301-01	Endothelin-1 (1-15) amide (Human)