Products for Research Use Only
RegisterLogin

Neuropeptide W-30 (human)

CAT: 0013-GTR19068042-01Size: 5 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19068042-01Size:5 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Neuropeptide W-30 is a peptide that has been shown to activate the receptor for neuropeptide W (NPW) . Neuropeptide W is a member of the tachykinin family of peptides, which are known to function as activators of G protein-coupled receptors. Neuropeptide W-30 has been shown to be a potent inhibitor of ion channels and ligand-gated ion channels, including potassium channels, calcium channels, and sodium channels. Neuropeptide W-30 also blocks the release of neurotransmitters such as acetylcholine, noradrenaline, dopamine, and serotonin in animal cells.
Purity
≥95%
Molecular Weight
3543.17
Notes
For research use only.
AA Sequence
WYKHVASPRYHTVGRAAGLLMGLRRSPYLW

Related Products

CatalogName
GTR18903832-01Neuropeptide W-30
GTR18903831-01Neuropeptide W-30
GTR19067900-01Neuropeptide W-30 (rat)
GTR19063028-01Neuropeptide W-30 (rat)
GTR19237280-01Neuropeptide W-23 (human)
GTR18918878-01Neuropeptide W-23 (human)
GTR19157649-01Neuropeptide W-23 (human)
GTR19034977-01Neuropeptide W-23 (human) (TFA)
GTR19034787-01Biotinyl-neuropeptide W-23 (human)
GTR18203826NPW/Neuropeptide W Polyclonal Antibody

Alternative Products

CatalogName
MBS8246823-01Neuropeptide W-30 (Human)
E-PP-1609-01Neuropeptide W-30, human
005-63Neuropeptide W-30 / L8C (Human)
302088Neuropeptide W-30, Human (NPW-30, L8C)
FN109734-01Neuropeptide W-30 (human) trifluoroacetate salt
FG-005-63ANeuropeptide W-30 / L8C (Human) - FAM Labeled
FR-005-63Neuropeptide W-30 / L8C (Human) - Rhodamine Labeled
T-005-63Neuropeptide W-30 / L8C (Human) - I-125 Labeled
H-5908.0005Neuropeptide W-23 (human)
MBS3612198-01Neuropeptide W-23(human)

Popular Products