β-Amyloid (1-43) (human)

CAT: 0013-GTR19066922-01Size: 5 mgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR19066922-01Size:5 mg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

β-Amyloid (1-43) (human) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43) (human) shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43) (human) could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use.

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4615.24

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT

Related Products

Catalog	Name
GTR18904205-01	Beta-Amyloid (1-43)
GTR19066982-01	β- Amyloid (37- 43)
GTR18891523	Amyloid beta-Protein (1-43) peptide
GTR18901239-01	Beta-Amyloid (37-43)
GTR18891311	Beta Amyloid (37-43) peptide
GTR18904206-01	Human Growth Hormone (1-43)
GTR19067144-01	β-Amyloid (1-42), human
GTR19067730-01	Human Growth Hormone (1-43)
GTR18918915-01	β-Amyloid (1-42), human
GTR19030030	β-Amyloid (1-37) (human)

Alternative Products

Catalog	Name
HY-P1378	β-Amyloid (1-43) (human)
T75930-01	β-Amyloid (1-43) (human) TFA
4370-v	Amyloid β-Protein (Human, 1-43)
HY-P1378A-01	β-Amyloid (1-43) (human) (TFA)
MBS5798883	beta-Amyloid (1-43, human)
20100017-1	Amyloid Beta-Protein (Human, 1-43)
MBS3841104-01	Amyloid b-Peptide (1-43) (human)
MBS5817835	beta-Amyloid (1-43)(human) TFA
018-06	Amyloid-beta Protein (1-43) (Human)
ALX-804-413-C100	β-Amyloid (1-43) (human) monoclonal antibody (6G12)

β-Amyloid (1-43) (human)

Related Products

Alternative Products

Popular Products