Products for Research Use Only
RegisterLogin

Recombinant Mouse Activin receptor type-2B (Acvr2b), partial (Active)

CAT: 0013-GTR19064610-01Size: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19064610-01Size:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Recombinant Mouse Activin receptor type-2B (Acvr2b), partial spans the amino acid sequence from region 19-137aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Name Alternative
Activin receptor type-2B; EC: 2.7.11.30; Activin receptor type IIB (ACTR-IIB) ; Acvr2b
UniProt
P27040
Expression Region
19-137aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Mus musculus (Mouse)
Field of Research
Signal Transduction
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2b at 2 μg/mL can bind Anti-ACVR2A&ACVR2B recombinant antibody. The EC50 is 3.560-4.235 ng/mL.
Form
Lyophilized powder
Molecular Weight
15.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTLLT

Related Products

CatalogName
GTR19066228-01Recombinant Human/Cynomolgus monkey Activin receptor type-2B (ACVR2B), partial (Active)
GTR19064611-01Recombinant Human/Cynomolgus monkey Activin receptor type-2B (ACVR2B), partial (Active)
GTR19025174-01Recombinant Human Activin receptor type-2B (ACVR2B), partial
GTR19077694-01Recombinant Mouse Activin receptor type-2B (Acvr2b)
GTR19077736-01Recombinant Rat Activin receptor type-2B (Acvr2b)
GTR19077748-01Recombinant Xenopus laevis Activin receptor type-2B (acvr2b)
GTR18836689-01Mouse Activin receptor type-2B (ACVR2B) ELISA Kit
GTR19064612-01Recombinant Mouse Activin receptor type-2A (Acvr2a), partial (Active)
GTR19023893-01Recombinant Human Activin Receptor 2B/Activin RIIB/ACVR2B (C-6His)
GTR19023591-01Recombinant Human Activin Receptor 2B/Activin RIIB/ACVR2B (C-Fc-6His)

Alternative Products

CatalogName
CSB-AP005701HU-01Recombinant Human Activin receptor type-2B (ACVR2B), partial (Active)
CSB-YP001261MO1-01Recombinant Mouse Activin receptor type-2B (Acvr2b), partial (Active)
RPC28821-01Recombinant Human Activin receptor type-2B (ACVR2B), partial , Active Protein
abx691855Mouse Activin A Receptor Type 2B (ACVR2B) Protein (Active)
abx691623Human Activin A Receptor Type 2B (ACVR2B) Protein (Active)
CSB-MP623829HU-01Recombinant Human/Cynomolgus monkey Activin receptor type-2B (ACVR2B), partial (Active)
MBS1476601-01Recombinant Pig Activin receptor type-2B (ACVR2B), partial
MBS9022004-01Recombinant Human Activin receptor type-2B (ACVR2B), Partial
AP73748-01Recombinant Human Activin receptor type-2B(ACVR2B), partial
MBS1445410-01Recombinant Chicken Activin receptor type-2B (ACVR2B), partial

Popular Products