Recombinant Leiurus quinquestriatus quinquestriatus Beta-insect excitatory toxin LqqIT1

CAT:
399-CSB-BP324858LDT-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Leiurus quinquestriatus quinquestriatus Beta-insect excitatory toxin LqqIT1 - image 1

Recombinant Leiurus quinquestriatus quinquestriatus Beta-insect excitatory toxin LqqIT1

  • UniProt:

    P19856
  • Expression Region:

    1-70aa
  • Organism:

    Leiurus quinquestriatus quinquestriatus (Egyptian scorpion) (Deathstalker scorpion)
  • Target Sequence:

    KKNGYAVDSSGKAPECLLSNYCYNECTKVHYADKGYCCLLSCYCVGLSDDKKVLEISDARKKYCDFVTIN
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Source:

    Baculovirus
  • Field of Research:

    Others
  • Assay Type:

    Developed Protein
  • Relevance:

    Excitatory insect beta-toxins induce a spastic paralysis. They bind voltage-independently at site-4 of sodium channels and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin induces a fast excitatory contraction paralysis on fly larvae. It is active only on insects.
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Full Length
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    11.7 kDa
  • References & Citations:

    "Primary structure of scorpion anti-insect toxins isolated from the venom of Leiurus quinquestriatus quinquestriatus." Kopeyan C., Mansuelle P., Sampieri F., Brando T., Bahraoui E.M., Rochat H., Granier C. FEBS Lett. 261:423-426 (1990)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3