Anti-SARS-CoV-2 NSP8 Antibody

CAT:
519-A34002
Size:
100 μg/Vial
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Anti-SARS-CoV-2 NSP8 Antibody - image 1

Anti-SARS-CoV-2 NSP8 Antibody

  • Background:

    Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19) . Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.
  • Description:

    Boster Bio Anti-SARS-CoV-2 NSP8 Antibody catalog # A34002. Tested in ELISA applications. This antibody reacts with Human.
  • Synonyms:

    Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp8; Non-structural protein 8
  • Gene Name:

    Non-structural protein 8
  • UniProt:

    P0DTC1/P0DTD1
  • Host:

    Rabbit
  • Reactivity:

    Human
  • Immunogen:

    AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
  • Clonality:

    Polyclonal
  • Tissue Specificity:

    Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. .
  • Applications:

    ELISA
  • Field of Research:

    Protein Phosphorylation, Ser/Thr Kinases, Signal Transduction
  • Purification:

    Immunogen affinity purified.
  • Concentration:

    Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
  • Form:

    Lyophilized
  • Reconstitution:

    Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
  • Function:

    Inhibitor of PPP1CA. Has over 1000-fold higher inhibitory activity when phosphorylated, creating a molecular switch for regulating the phosphorylation status of PPP1CA substrates and smooth muscle contraction.
  • Storage Conditions:

    Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
  • Fragment:

    Rabbit IgG
  • Applications Notes:

    ELISA, 0.001-0.1μg/ml, Human
  • Other Gene Names:

    Rep
  • Subcellular Location:

    Cytoplasm .