Products for Research Use Only
RegisterLogin

Ebf4 Peptide - middle region

CAT: 0013-GTR19050869Size: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19050869Size:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Ebf4 Peptide - middle region
Product Name Alternative
Ebf3, O/E-4, Olf-1
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ebf4 Rabbit Polyclonal Antibody (orb576327) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_694538
Preservative
Lyophilized powder
AA Sequence
ARSCGSASPRFAPSPGSQQSSYGSGLGAGLGSYGAPGVTGLGVPGSPSFL

Related Products

CatalogName
GTR19048153EBF4 Peptide - C-terminal region
GTR19058793EBF4 Peptide
GTR19053999EBF4 Peptide
GTR19059291EBF2 Peptide - middle region
GTR19004385EBF4 Antibody Blocking Peptide
GTR19050616FLJ30934 Peptide - middle region
GTR19050602GJC3 Peptide - middle region
GTR19050581Foxj1 Peptide - middle region
GTR19050579Foxj1 Peptide - middle region
GTR19050578Foxj3 Peptide - middle region

Alternative Products

CatalogName
MBS3228587-01Ebf4 Peptide - middle region
AAP37501-100UGEbf4 Peptide - middle region (AAP37501)
MBS3201254-01EBF4 antibody - middle region
AMM05861GPolyclonal EBF4 antibody - middle region
ARP37501_P050Ebf4 antibody - middle region (ARP37501_P050)
MBS3235356-01EBF4 Peptide - C-terminal region
ARP37501_P050-HRPEbf4 Antibody - middle region : HRP (ARP37501_P050-HRP)
ARP37501_P050-FITCEbf4 Antibody - middle region : FITC (ARP37501_P050-FITC)
ARP37501_P050-BiotinEbf4 Antibody - middle region : Biotin (ARP37501_P050-Biotin)
AAP51732-100UGEBF4 Peptide - C-terminal region (AAP51732)

Popular Products