Products for Research Use Only
RegisterLogin

INKA2 Peptide - middle region

CAT: 0013-GTR19047955Size: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19047955Size:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
INKA2 Peptide - middle region
Product Name Alternative
Fam212b, RGD1306526
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INKA2 Rabbit Polyclonal Antibody (orb326235) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001101183
Preservative
Lyophilized powder
AA Sequence
DNVFADLVGNWLDLPELEKGGERGETGGSGEPKGEKGQSRELGRKFALTA

Related Products

CatalogName
GTR19045393INKA1 Peptide - middle region
GTR18992796INKA2 Antibody Blocking Peptide
GTR19004015INKA2 Antibody Blocking Peptide
GTR19004082INKA2 Antibody Blocking Peptide
GTR19050616FLJ30934 Peptide - middle region
GTR19050602GJC3 Peptide - middle region
GTR19050581Foxj1 Peptide - middle region
GTR19050579Foxj1 Peptide - middle region
GTR19050578Foxj3 Peptide - middle region
GTR19050568FOXN3 Peptide - middle region

Alternative Products

CatalogName
MBS3238512-01INKA2 Peptide - middle region
AAP69810-100UGINKA2 Peptide - middle region (AAP69810)
AAP57803-100UGINKA2 Peptide - middle region (AAP57803)
AAP57804-100UGINKA2 Peptide - middle region (AAP57804)
MBS3213569-01INKA2 Antibody - middle region
ARP57804_P050-HRPINKA2 Antibody - middle region : HRP (ARP57804_P050-HRP)
ARP69810_P050-FITCINKA2 Antibody - middle region : FITC (ARP69810_P050-FITC)
ARP69810_P050-BiotinINKA2 Antibody - middle region : Biotin (ARP69810_P050-Biotin)
ARP57803_P050-FITCINKA2 Antibody - middle region : FITC (ARP57803_P050-FITC)
ARP69810_P050-HRPINKA2 Antibody - middle region : HRP (ARP69810_P050-HRP)

Popular Products