Products for Research Use Only
RegisterLogin

MAPKAP1 Peptide - N-terminal region

CAT: 0013-GTR19041885Size: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19041885Size:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
MAPKAP1 Peptide - N-terminal region
Product Name Alternative
MIP1, SIN1, JC310, SIN1b, SIN1g
UniProt
Q9BPZ7
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MAPKAP1 Rabbit Polyclonal Antibody (orb588524) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTAT

Related Products

CatalogName
GTR19053093MAPKBP1 Peptide - N-terminal region
GTR19038051MAPKAP1 Peptide - middle region
GTR19041007MAPKAPK2 Peptide - N-terminal region
GTR19040686MAPK8IP1 Peptide - N-terminal region
GTR19042585MAPK11 Peptide - N-terminal region
GTR19046094Mapk11 Peptide - N-terminal region
GTR19038502MAPK11 Peptide - N-terminal region
GTR19041781WAS Peptide - N-terminal region
GTR18916932MAPKAP1 Peptide
GTR18916931MAPKAP1 Peptide

Alternative Products

CatalogName
MBS3244935-01MAPKAP1 Peptide - N-terminal region
AAP75757-100UGMAPKAP1 Peptide - N-terminal region (AAP75757)
MBS3220104-01MAPKAP1 Antibody - N-terminal region
MBS3248488-01MAPKAP1 Peptide - middle region
ARP75757_P050-HRPMAPKAP1 Antibody - N-terminal region : HRP (ARP75757_P050-HRP)
ARP75757_P050-BiotinMAPKAP1 Antibody - N-terminal region : Biotin (ARP75757_P050-Biotin)
ARP75757_P050-FITCMAPKAP1 Antibody - N-terminal region : FITC (ARP75757_P050-FITC)
AAP97174-100UGMAPKAP1 Peptide - middle region (AAP97174)
MBS3244795-01WAS Peptide - N-terminal region
MBS3236768-01GBP2 Peptide - N-terminal region

Popular Products