Products for Research Use Only
RegisterLogin

APC Peptide - middle region

CAT: 0013-GTR19040345Size: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19040345Size:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
APC Peptide - middle region
Product Name Alternative
GS, DP2, DP3, BTPS2, DP2.5, PPP1R46
UniProt
E9PFT7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with APC Rabbit Polyclonal Antibody (orb589364) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000029.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SETFDNIDNLSPKASHRSKQRHKQSLYGDYVFDTNRHDDNRSDNFNTGNM

Related Products

CatalogName
GTR19050616FLJ30934 Peptide - middle region
GTR19050602GJC3 Peptide - middle region
GTR19050581Foxj1 Peptide - middle region
GTR19050579Foxj1 Peptide - middle region
GTR19050578Foxj3 Peptide - middle region
GTR19050568FOXN3 Peptide - middle region
GTR19050560Frg1 Peptide - middle region
GTR19050548FSTL5 Peptide - middle region
GTR19050547GLCCI1 Peptide - middle region
GTR19050534PACS2 Peptide - middle region

Alternative Products

CatalogName
MBS3233907-01ERH Peptide - middle region
MBS3246616-01STX17 Peptide - middle region
MBS3246611-01CACNA2D3 Peptide - middle region
MBS3245527-01LILRA5 Peptide - middle region
MBS3246602-01PEX16 Peptide - middle region
MBS3246598-01TAGLN2 Peptide - middle region
MBS3246596-01PHYH Peptide - middle region
MBS3246577-01CTSE Peptide - middle region
MBS3246573-01PEX2 Peptide - middle region
MBS3246565-01NPTX2 Peptide - middle region

Popular Products