Products for Research Use Only
RegisterLogin

CDK2AP1 Peptide - middle region

CAT: 0013-GTR19040095Size: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19040095Size:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CDK2AP1 Peptide - middle region
Product Name Alternative
DOC1, ST19, DORC1, doc-1, p12DOC-1
UniProt
O14519
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDK2AP1 Rabbit Polyclonal Antibody (orb588702) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001257362.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEEL

Related Products

CatalogName
GTR19047348CDK2AP1 Peptide - C-terminal region
GTR18905446-01CDK2AP1 peptide
GTR18968886CDK2AP1 Antibody Blocking peptide
GTR19050616FLJ30934 Peptide - middle region
GTR19050602GJC3 Peptide - middle region
GTR19050581Foxj1 Peptide - middle region
GTR19050579Foxj1 Peptide - middle region
GTR19050578Foxj3 Peptide - middle region
GTR19050568FOXN3 Peptide - middle region
GTR19050560Frg1 Peptide - middle region

Alternative Products

CatalogName
MBS3245249-01CDK2AP1 Peptide - middle region
AAP76737-100UGCDK2AP1 Peptide - middle region (AAP76737)
MBS3220448-01CDK2AP1 Antibody - middle region
ARP76737_P050CDK2AP1 Antibody - middle region (ARP76737_P050)
MBS3241239-01CDK2AP1 Peptide - C-terminal region
AAP64230-100UGCDK2AP1 Peptide - C-terminal region (AAP64230)
MBS3233907-01ERH Peptide - middle region
MBS3246616-01STX17 Peptide - middle region
MBS3246611-01CACNA2D3 Peptide - middle region
MBS3245527-01LILRA5 Peptide - middle region

Popular Products