Products for Research Use Only
RegisterLogin

Copeptin Active Peptide

CAT: 0013-GTR19035642-01Size: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19035642-01Size:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This product is Copeptin Active Peptide. Its protein sequence is SDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY. Targets Vasopressin-neurophysin 2-copeptin. Purified using HPLC.
Product Name Alternative
Vasopressin; Antidiuretic Hormone; Arginine Vasopressin; ADH; Arginine vasopressin neurophysin II; ARVP; AVP; AVP NPII; AVRP; Vasopressin neurophysin 2 copeptin precursor; Vasopressin neurophysin II copeptin; VP.
Field of Research
Hormone Research
Form
Lyophilized
Molecular Weight
3.95 kDa
Storage Conditions
Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.
Notes
For research use only.
AA Sequence
SDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY

Related Products

CatalogName
GTR19066585-01Copeptin (human)
GTR19000279Obestatin active peptide
GTR19007100Sauvagine active peptide
GTR18993098OGP Active Peptide
GTR19259777-01Copeptin (rat)
GTR18985672Copeptin Antigen
GTR19066584-01Copeptin (rat)
GTR19341737Copeptin Antigen-BSA
GTR18993160-01LL-37 active peptide
GTR18992500MBP68-86 Active Peptide

Alternative Products

CatalogName
abx651021-01Human Copeptin (CPP) Peptide (OVA)
abx165521-01Human Copeptin (CPP) Peptide (KLH)
BRP1003C-Peptide Protein (Active)
MBS2153545-01Active Cathelicidin Antimicrobial Peptide (CAMP)
abx260522-01Human Glucagon (GC) Peptide (Active)
MBS2162440-01Active Glutaminyl Peptide Cyclotransferase (QPCT)
33R-10690Active Caspase 8 Blocking Peptide
TRV-043345-01Active Galanin Like Peptide (GALP)
MBS2162313-01Active Calcitonin Gene Related Peptide (CGRP)
RPU60762-01Human Glutaminyl Peptide Cyclotransferase, Active Protein

Popular Products