Products for Research Use Only
RegisterLogin

Recombinant Human CD59

CAT: 0013-GTR19035414-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19035414-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant Human CD59
Field of Research
Immunology & Inflammation
Endotoxin
Less than 0.1 EU/ugof rHuCD59 as determined by LAL method.
Purity
> 97 % by SDS-PAGE analyses.
Bioactivity
Testing in progress.
Form
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.0, with 1 mM DTT, 5 % trehalose.
Molecular Weight
Approximately 9.0 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids.
Storage Conditions
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Notes
For research use only.
AA Sequence
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Related Products

CatalogName
GTR18574473Recombinant CD59 Antibody
GTR18574474Recombinant CD59 Antibody
GTR18571339-01Recombinant CD59 Antibody
GTR18571373Recombinant CD59 Antibody
GTR18082526-01Recombinant CD59 Antibody
GTR18571374-01Recombinant CD59 Antibody
GTR18571338Recombinant CD59 Antibody
GTR18871258-01Human CD59 (CD59 glycoprotein) ELISA Kit
GTR18887350-01Human CD59 protein
GTR19343688-01CD59 siRNA (Human)

Alternative Products

CatalogName
AP70139-01Recombinant Human CD59 glycoprotein(CD59)
CSB-YP004947HU-01Recombinant Human CD59 glycoprotein (CD59)
R2116hHuman CD59 / CD59 glycoprotein Recombinant Protein
P1598-.5Recombinant Human CD59
BLT-06783P-01Human CD59 (Cd59 Glycoprotein) - Recombinant Protein
rAP-0078CD59 Human Recombinant
PROTP13987-01Human CD59 Recombinant Protein
E30P11254Recombinant Human CD59 Protein
TP726732CD59 Human Recombinant Protein
156487-01Protectin (CD59) Recombinant, Human

Popular Products