Products for Research Use Only

PEP1

CAT: 0013-GTR19035041-01Size: 50 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19035041-01Size:50 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
PEP1 is a bioactive peptide that binds to POPC supported lipid bilayers at low concentrations and induces their lysis at higher concentrations. This makes it a useful tool for studying membrane interactions, peptide-induced bilayer disruption, and mechanisms of lytic activity in both in vitro biophysical and cell-based assays.
Field of Research
Metabolism Research
Molecular Weight
3805.27
Storage Conditions
-20°C
Notes
For research use only.
AA Sequence
Ser-Gly-Ser-Trp-Leu-Arg-Asp-Val-Trp-Asp-Trp-Ile-Cys-Thr-Val-Leu-Thr-Asp-Phe-Lys-Thr-Trp-Leu-Gln-Ser-Lys-Leu-Asp-Tyr-Lys-Asp-NH2; Sequence Short: SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2