Products for Research Use Only
RegisterLogin

Recombinant Human papillomavirus type 16 Probable protein E5 (E5)

CAT: 0013-GTR19028336-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19028336-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Recombinant Human papillomavirus type 16 Probable protein E5 (E5) spans the amino acid sequence from region 1-83aa. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt
P06927
Expression Region
1-83aa
Tag
N-terminal 10xHis-tagged and C-terminal GST-tagged
Source
In vitro E.coli expression system
Origin
Human papillomavirus type 16
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
36.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MTNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCFIVYIIFVYIPLFLIHTHARFLIT

UniProtKB · P06927

Probable protein E5

VE5_HPV16 · Human papillomavirus type 16

View on UniProt ↗
Primary accession
P06927
Review status
UniProtKB reviewed (Swiss-Prot)
Gene
E5
Protein existence
1: Evidence at protein level
Organism
Human papillomavirus type 16
Taxonomy ID
333760
Alternative names
—
EC number
—
Processing
—
Secondary accessions
Q71BI2
Protein keywords

Developmental stage

Early protein

Cellular component

Host endoplasmic reticulumHost Golgi apparatusHost membraneMembrane

Biological process

Host-virus interactionInhibition of host adaptive immune response by virusInhibition of host MHC class I molecule presentation by virusViral immunoevasion

Technical term

Reference proteome

Domain

TransmembraneTransmembrane helix

Related Products

CatalogName
GTR19031971-01Recombinant Human papillomavirus type 18 Probable protein E5 (E5)
GTR19065120-01Recombinant Human papillomavirus type 16 Protein E6 (E6)
GTR19026664-01Recombinant Human papillomavirus type 16 Protein E6 (E6)
GTR19025673-01Recombinant Human papillomavirus type 16 Protein E6 (E6)
GTR19009399-01Recombinant Human Papillomavirus L1 Protein (HPVL1), type 16
GTR19009553-01Recombinant Human papillomavirus type 16 Protein E7 (E7)
GTR19065016-01Recombinant Human papillomavirus type 16 Protein E7 (E7)
GTR19025504-01Recombinant Human papillomavirus type 16 Protein E7 (E7)
GTR19065373-01Recombinant Human papillomavirus type 16 Regulatory protein E2 (E2)
GTR19009863-01Recombinant Human papillomavirus type 16 Regulatory protein E2 (E2)

Alternative Products

CatalogName
MBS1058660-01Recombinant Probable protein E5 (E5)
MBS1260015-01Recombinant Rhesus papillomavirus type 1 Probable protein E5 (E5)
CSB-CF361986HMLg8-01Recombinant Human papillomavirus type 16 Probable protein E5 (E5)
CSB-EP361950HMN-01Recombinant Human papillomavirus type 18 Probable protein E5 (E5)
MBS7062607-01Recombinant Probable protein E5 (E5), partial
MBS1158259-01Recombinant Human papillomavirus type 16 Probable protein E5 (E5), Biotin conjugated
MBS1068968-01Recombinant Cottontail rabbit papillomavirus Probable protein E5 (E5)
MBS1304144-01Recombinant Probable protein E5A (E5)
MPX1029KMagic™ Membrane Protein Human papillomavirus type 16 E5 (Transforming protein E5) Expressed in vitro E.coli expression system, Full Length
MBS1228613-01Recombinant Rhesus papillomavirus type 1 Probable protein E4 (E4)

Popular Products